KEGG   Fibrobacter succinogenes: Fisuc_0118Help
Entry
Fisuc_0118        CDS       T01099                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fsu  Fibrobacter succinogenes
Brite
KEGG Orthology (KO) [BR:fsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fsu01001]
    Fisuc_0118
Enzymes [BR:fsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Fisuc_0118
Protein kinases [BR:fsu01001]
 Serine/threonine kinases: Other
  Bacterial family
   Fisuc_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ACX73732
UniProt: C9RJL9
LinkDB All DBs
Position
127461..128966
Genome map
AA seq 501 aa AA seqDB search
MIRPEQPLNFPYPFNENYELLGTLGKGGMGYVYKALDKRLNREVAFKILDSTSDVEAIKR
FYLEAQAMKELDHQNIVHVFDFGQQGNQLFISMTYVQGISLAEILQNKSKLSFEAIEVII
KQIARGLLYAHSKGIVHRDVKPSNIMLTRDNRVYIMDFGISYIQEMEKERLTRTGMTMGT
PEYMSPEQCHGDEVTLQSDIYSMGVILYEMTCGRLPFEGSRPVEIALKHVQEPPPAPELF
REDIPDGLSALILKCLKKKLNERFHDMQEFLDECDQVFPQHDTPYQNSSVGRKTGSHRSV
PSIAEAAKRFGSNLTPHKLIIVAFSVLFPLIVILLMLLMFTHKPQNMLHEVEWSEVIANY
ETRAIEPEMKKGYPIENLTDGDLTTAWLNKMPLKPLNPVLAMYFDQNTLITNIGIAVGYQ
KSVDDAFGDRFRIFKKPHTLTIETKDGFKQRIKLENIRGMQYPNIQAVETTELRFYLEDV
YEADNDDYAISEIRLLGMEVE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtccagaacaaccgctaaattttccgtacccctttaacgaaaactacgaacta
ttgggaacgctcggcaaaggcggaatgggctatgtctacaaggccctcgataaaaggctg
aaccgcgaagtcgccttcaagatactcgactccacctccgatgtcgaagccatcaagcgt
ttctatctcgaagcgcaggccatgaaggagctcgaccaccaaaacatcgttcacgtgttc
gactttggccagcagggcaaccagctctttatttcgatgacttacgtgcaaggtatttcg
cttgccgaaattttgcaaaacaagagcaaactttcctttgaggccattgaagtcatcatc
aagcaaattgcacgcggtctcctttacgcgcacagcaagggcatcgtccaccgcgacgtg
aagccatcaaacatcatgctcacgcgcgacaaccgcgtctacatcatggactttggcatt
tcatacatccaggagatggaaaaggaacgcctcacccgcaccggcatgaccatgggtacg
cccgaatacatgtcgcccgaacagtgccacggtgacgaagtcacgctccagtccgacatt
tatagcatgggcgtgatcctttacgaaatgacttgcggacgtttgccgttcgaaggcagc
cgccctgtggaaattgcgctcaagcacgtgcaggaaccgcctccggctccggaacttttc
cgcgaagatatcccggacggactttcggcgctcatcctcaagtgcctcaagaaaaagctg
aacgaacgcttccacgacatgcaggaattcttggacgaatgcgaccaggtattcccgcag
cacgacacaccgtatcagaattcttctgtcggtcgcaagaccggcagccaccgcagcgtt
ccttccattgcagaagcggccaagcgattcggcagcaacctcactccgcacaaactcatc
attgttgcgttctcggtgctgttcccgctcatcgtgattttactcatgctcctcatgttc
acgcacaaaccgcagaacatgttgcatgaagttgaatggagcgaggtcatcgcaaactac
gaaacgagagccatcgagcccgaaatgaaaaagggttacccgattgagaacttgactgac
ggcgacctcaccacggcatggctcaacaagatgccgctcaagccgttgaacccggtgctc
gccatgtactttgaccagaacacgctcatcacgaacatcggcattgctgttggctaccag
aagtccgtagatgacgctttcggcgaccgcttccgcattttcaagaaaccgcacacgctc
accattgagacaaaggacggattcaagcaacgcatcaagctcgaaaatattaggggaatg
cagtacccgaacattcaggctgttgaaacgacggagctccggttctaccttgaagacgtt
tacgaagctgacaacgacgactacgctatttcggaaatccgcttgcttgggatggaagtg
gagtag

DBGET integrated database retrieval system