KEGG   Candidatus Frankia datiscae: FsymDg_0002
Entry
FsymDg_0002       CDS       T01530                                 

Definition
(GenBank) membrane protein insertase, YidC/Oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
fsy  Candidatus Frankia datiscae
Pathway
fsy02024  Quorum sensing
fsy03060  Protein export
fsy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    FsymDg_0002
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    FsymDg_0002
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FsymDg_0002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fsy03029]
    FsymDg_0002
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:fsy02044]
    FsymDg_0002
Mitochondrial biogenesis [BR:fsy03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    FsymDg_0002
Secretion system [BR:fsy02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   FsymDg_0002
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-ProteinID: AEH07595
UniProt: F8B069
LinkDB
Position
complement(943..2298)
AA seq 451 aa
MLDPLYHLAANAIVFFHGGFGPIFGRDSFFAWALSVVLLVICVRIMIFPLFVKQVKAQRT
MQLMQPKIKEIRDKYGHDRQQMNAKIMELQKEHGNPLLGCLPILLQIPLFIALFHVFSHL
RPVDRPGGVLEWAPRVGLTAQQVQQIAEAKLLGVSLSTSFTSSSNFLEFVQANGTNVKIF
AVTLIVLMGATTFLTQRQIMARTGPVDPQQAIVQKVLLYGSPIMLAVFGFQFPIAVLLYW
LTTNLWSMGQQFFVIKKMPPPAVQGAGGQVPSTRSAPGAKNASGTKNRTSQPAPARPAPG
ARPTNKGKNRPGAASPATGSTAASTDRTPGGAGQAETGAGKTANSNKAVRKAPPGTRSPR
GGSAQSSQPAQQPAQPKQPTQPARPSKASDAAEAGEAVPQPAQTQNGSAPAGDDAQPRAG
KPHATAGVRRHTGGSRPAKRRGKGGRPGGRR
NT seq 1356 nt   +upstreamnt  +downstreamnt
gtgctggatcccctctaccatctcgcggcgaacgcgatcgtcttctttcacgggggcttc
gggccgatcttcggccgggacagcttcttcgcgtgggcgctgtcggtcgtcctgctggtg
atctgcgtccggatcatgatctttccgctgttcgtcaagcaggtgaaggcccagcggacg
atgcagctgatgcagccgaagatcaaggagatccgggacaagtacggccatgaccggcag
cagatgaatgccaagatcatggagttgcagaaggaacatggcaacccgctgctcgggtgc
ctgccgatcctgctccagatccccctgttcatcgcgctgttccacgtcttcagccacctg
cggccggtcgaccggcccggcggcgtgctggagtgggctccccgggtcgggctgaccgcc
caacaggtgcagcagatcgccgaggccaagctgctcggcgtctcgctgtccacctcgttc
acctcgtcgtcgaacttcctggagttcgtccaggcgaacgggacgaacgtcaagatcttc
gcggtcacgctgatcgtcctgatgggtgcgacgacgttcctcacccagcggcagatcatg
gcgcggaccgggccggtcgatccgcagcaggcgatcgtgcagaaggtcctgctctacggc
tccccgatcatgctcgcggtgttcggcttccagttcccgatcgctgtcctgctgtactgg
ctgaccaccaacctgtggagcatgggccagcagttctttgtgatcaagaagatgccgccg
ccggccgtgcagggcgccggtgggcaggtgccgagcacccggtcggcgcccggggcgaag
aacgcgtccgggacgaagaacaggacatcgcagccggcgccggcccgtcccgcaccaggt
gcccggccaaccaacaagggtaagaaccgaccgggtgcggcctcgccggccacgggctcg
accgccgcgtcgaccgacaggacgccgggtggcgcaggccaggccgaaaccggagccggc
aagacggcgaactccaacaaggccgtgcgcaaggctccgccaggaacccgttccccccga
ggcggctccgcgcagtcctcgcagccggcccagcagccggcccagccgaaacagccgact
cagcccgcccgcccgtcgaaggcatccgacgcggccgaggccggcgaggcggtaccgcag
ccggcgcagacacagaacgggtccgctccggccggtgacgacgcccagccccgggcggga
aagccccatgccacggcgggcgtacgccggcatacaggtggttcccggcccgccaagcga
cgtggcaagggcggccgccccggaggccgacggtga

DBGET integrated database retrieval system