KEGG   Frankia symbiont: FsymDg_0178Help
Entry
FsymDg_0178       CDS       T01530                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fsy  Frankia symbiont
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fsy01001]
    FsymDg_0178
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     FsymDg_0178
Protein kinases [BR:fsy01001]
 Serine/threonine kinases: Other
  Bacterial family
   FsymDg_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Pkinase_fungal Kinase-like RIO1 DUF4853
Motif
Other DBs
NCBI-ProteinID: AEH07751
UniProt: F8B2N1
LinkDB All DBs
Position
224694..226607
Genome map
AA seq 637 aa AA seqDB search
MTEAFGTEPRLVGGRYELGEVLGYGGMAEVYRGRDVRLGREVAVKALRADLARDPTFLAR
FRREAQSSAALNHPAIVSVYDTGEDLINGTTVPYIVMEYVEGRTLRDVLQQEGRFSERRA
MEITSDVCAALDYSHRMGIIHRDIKPANVMLCQDGSVKVMDFGIARATTATTSNMTQTAA
VIGTAQYLSPEQARGVRVDARSDVYSTGVLFYELLTGQPPFRGDSPVAVAYQHVRENPQP
PSSHDRAITPNADAIVFKAMEKDPDHRYSTAGLMRDDLERALAGRPIYAPQLDSDQLTTR
LGASPAVTAGTHMISRGRGPYDDGPDDPYGRTGGYGTGGYDRAGFGGPGGGDSGPLPEKR
RSDAWKYILAGLSVVAVFVVVTMIATNMLGGGGGNGDDTTADTATIPTNLIGQKFETAKN
SLSSAGFTNIVSKVVENNEPKDLVVEVDPAPGTAASKSAPITLSISKGPGDLAVPDVAGL
TQAAATAKLKEAGLTVKTSAFTDATTRRAGLVESSDPAAGTSVAPGDDVIIYVVSTQATV
PNVTDQPVDPAKSELERYGFRVVQQAVASSKPTGTVVSQSPGGGSAARGSTVTLYVSQQQ
AINTQTPTPSPSASATPSKTPSPNPSSTGGGLGGLLG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaggcgttcggaaccgaacctcgcctggtgggcgggcgctacgagctgggcgag
gtcctcgggtacggcggcatggccgaggtctaccgcggccgggacgtccgcctcggccgc
gaggtcgcggtcaaggcgctgcgggccgacctcgcccgggacccgaccttcctggcccgc
ttccgccgcgaggcgcagtcctcggccgccctgaaccacccggcgatcgtctcggtctac
gacaccggcgaggatctgatcaacggcacgaccgtcccgtacatcgtgatggagtacgtg
gaaggccgcaccctgcgggatgtgctccagcaggagggccggttcagtgaacgccgggcc
atggagatcacctccgacgtgtgcgcggccctggactacagccaccggatggggatcatc
caccgggacatcaagcccgccaacgtcatgctgtgccaggacggctcggtcaaggtgatg
gacttcggcatcgcccgggcgaccaccgcgaccacgtccaacatgacgcagaccgccgcg
gtgatcggcaccgcccagtacctgtcgccggaacaggcccgcggcgtccgtgtggacgcg
cgcagcgacgtctactcgacgggtgtgctgttctacgagctgctgaccgggcagccgccg
ttccgtggcgactcaccggtggccgtcgcctaccagcacgtgcgggagaatcctcagccg
ccgtccagccacgaccgcgccatcacgcccaacgccgacgcgatcgtgttcaaggcgatg
gagaaggatcccgaccaccgctactccaccgccgggctgatgcgggacgacctcgagcgg
gccctggccggccgccccatctacgccccccagctcgacagcgaccagctcaccacccgg
ctgggcgcctcacccgcggtcaccgcggggacacacatgatctcccgcggccgcggcccc
tacgacgacggtccggacgacccctacggccgcaccggcggctacgggacgggcggttac
gaccgggccggcttcggcggccccggggggggcgacagcgggccgctgccggagaaaaga
cgttcggacgcctggaagtacattctcgccggcctgtccgtggtggcggtgttcgtcgtc
gtcaccatgatcgcgaccaacatgctcggcggcgggggcgggaacggcgacgacaccacc
gccgacaccgcgacgatcccgacgaacctcatcgggcagaagttcgagacggccaagaac
agcctgagctccgccggcttcaccaacatcgtctcaaaggtcgtcgagaacaacgagccg
aaggacctggtggtcgaggtcgacccggccccgggcaccgccgcctcgaagagcgcgccg
atcaccctcagcatctcgaaggggccgggtgacctcgccgttccggacgtggccgggctg
acccaggccgcggccaccgccaagctgaaggaggccgggctgacggtgaagacctccgcc
ttcaccgacgcgacgacccgccgagccggactggtcgagtccagcgacccggcggcaggc
acgtcggtggctcctggtgacgatgtgatcatctacgtggtgagcacgcaggcgaccgtc
ccgaacgtgacggaccagcctgtcgaccccgccaagtccgaactggagcgctacggcttc
agggtcgtccagcaggccgtcgcgagcagcaagccgacgggcaccgtcgtctcccagagc
cccggcggcggctcggcggcccgcgggtcgaccgtgacgctctacgtctcccagcagcag
gccatcaacacccagacgcccacaccgtcaccgagcgccagcgcgactccgagcaagaca
ccgtcgccgaacccgagctccaccggcggcggcctcggcggcctgctcggctga

DBGET integrated database retrieval system