KEGG   Frankia symbiont: FsymDg_1432Help
Entry
FsymDg_1432       CDS       T01530                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
fsy  Frankia symbiont
Pathway
fsy00020  Citrate cycle (TCA cycle)
fsy00190  Oxidative phosphorylation
fsy00650  Butanoate metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01200  Carbon metabolism
Module
fsy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fsy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fsy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FsymDg_1432
   00650 Butanoate metabolism
    FsymDg_1432
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FsymDg_1432
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FsymDg_1432
    1.3.5.4  fumarate reductase (quinol)
     FsymDg_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_10 Fer4_18 Fer4_7 Fer4_9 Fer2_4
Motif
Other DBs
NCBI-ProteinID: AEH08900
UniProt: F8B3D9
LinkDB All DBs
Position
complement(1673248..1674006)
Genome map
AA seq 252 aa AA seqDB search
MAAYDLSLRVWRGDADSGDLQDYTVGVEEGMVVLDALHRLQQTQAPDLAVRWNCKAGKCG
SCSAEVNGRPRLTCMTRLNLFAPTDTVTVTPLRTFPVIRDLVTDVSYNYEKAAQVPAFAP
GAPAGDDGHHRMKQSDVDRVQEFRTCIECFLCQTVCHVIRDHEENKPVFAGPRLMIRYAE
LEMHPLDTHDRRDLLRGQADIGYCNITKCCTEVCPEHISITDNAIIPLKERVVDTAYDPI
TRLGNRILRRRR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctacgatctttcgctgcgggtgtggcggggcgatgccgacagtggtgatctc
caggactacacggtcggtgtcgaagagggcatggtcgtcctggacgcgctgcaccggctc
cagcagacgcaggcgcccgatctggccgtccgctggaactgcaaggccggcaagtgcggg
tcgtgcagcgccgaggtgaacggccgcccccggctgacatgcatgacccggctgaacctg
ttcgcgcccacggacaccgtcacggtgacgccgctgcggacgttcccggtgatccgggat
ctggtcaccgacgtctcgtacaactacgagaaggccgcgcaggtgccggcgttcgccccg
ggagcaccggcaggggacgacgggcaccaccggatgaagcagtccgacgtcgaccgcgtc
caggagttccgcacgtgcatcgagtgcttcctgtgccagacggtctgccatgtcatccgc
gatcatgaggagaacaagcccgtcttcgccggcccacggttgatgatccggtacgccgaa
ctggaaatgcacccgttggacacacatgatcggcgagatctgctgcgcggacaggccgac
atcgggtactgcaacatcacgaaatgctgcacagaagtctgcccggagcacatctcgatc
accgacaacgccatcataccgctcaaggaaagggtcgtcgacaccgcatacgacccgatc
acgcggctcggcaaccgcatcctgcgccgtcggcgctga

DBGET integrated database retrieval system