KEGG   Frankia symbiont: FsymDg_1433Help
Entry
FsymDg_1433       CDS       T01530                                 

Definition
(GenBank) Succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
fsy  Frankia symbiont
Pathway
fsy00020  Citrate cycle (TCA cycle)
fsy00190  Oxidative phosphorylation
fsy00650  Butanoate metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01200  Carbon metabolism
Module
fsy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fsy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fsy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FsymDg_1433
   00650 Butanoate metabolism
    FsymDg_1433
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FsymDg_1433
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FsymDg_1433
    1.3.5.4  fumarate reductase (quinol)
     FsymDg_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_oxidored HI0933_like Thi4 FAD_binding_3 GIDA Pyr_redox_3 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEH08901
UniProt: F8B227
LinkDB All DBs
Position
complement(1674006..1676075)
Genome map
AA seq 689 aa AA seqDB search
MSTSERHTYDVVVIGAGGAGLRAALEAHEQGARVAVVCKSLLGKAHTVMAEGGIAAAMGN
VWPEDNWQTHFRDTMRGGKMLNQWQMARIHAEEAPARVWELEEWGAVFDRTPDGRILQRD
FGGHRFARLAHVGDRTGLELIRTLQNRLISKRIDVFMECTVLRLLTVPGAADTPGAGRAS
GEPDALSAPAPAPARERGSARVAGRIAGAFAYWRESGTFVRFDAPAMVLATGGIGKSYQV
TSNSWEYTGDGHALALWAGAALMDMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLLNS
EGRRFMFDYIPPVFAAETADSEEEADRWYTDKKTARRPPELLPRDEVARAINAEIKAGRG
SPHGGVHLDIASRRDPEYIRRRLPSMYHQFTELADVDITREPMEVGPTCHYVMGGIKVDP
STAAATVPGLFAAGECAAGMHGSNRLGGNSLSDLLVFGRRAGLHAARYAQSLPARKRAVA
DDAQIDATAAAALAPFAAALTPGSVQAGTASAEGTASSARGTTSARDSARTSVSPSHPPE
NPYQLQNDLQDVMQRLVGIIRTESELVRALKEIETLRSRARHVAVVGHRQYNPGWHLALD
LGSLLTVAECITTAALARRESRGGHTRDDYPSADPAFATLNHVLRLRDGRLVLTTEPLPA
MPPELAALFEDAGAESRADRGAPAGGKGS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatcggaaagacacacatacgacgtcgtcgtgatcggcgcgggcggagcgggc
ctgcgggccgcgctggaagcgcatgagcagggtgcccgggtcgccgtcgtctgcaagagc
ctgctcggcaaggcccacaccgtgatggccgagggtggtatcgcggccgcgatgggcaat
gtctggcccgaggacaactggcagacgcacttccgcgacacgatgcgcggcgggaagatg
ctcaaccagtggcagatggcccggatccacgccgaggaggccccggcacgggtctgggaa
ctggaggaatggggcgcggtcttcgaccggacgccggacggccggatcctccagcgcgac
ttcggcggtcaccgtttcgcccggctcgcgcacgtcggggaccgtaccggcctcgagctg
atccgcaccctgcagaaccggctgatcagcaagaggatcgacgtcttcatggagtgcacg
gtgttacgcctgctgaccgtgccgggggcagcggatacgccgggcgccgggcgggcgtcg
ggcgaacccgacgcactgtccgccccggcgcccgccccggcgcgcgaacgcggctcggcg
cgcgtggccgggcggatcgccggcgccttcgcgtactggcgcgagtccggcaccttcgtg
cgtttcgacgcgcccgcaatggtgctcgccaccggggggatcggcaagtcctaccaggtg
acgtcgaactcgtgggagtacaccggcgacggccacgcgctcgcgctgtgggccggggcc
gcgctgatggacatggagttcgtccagttccatcccaccgggatggtctggccaccttcg
gtgaagggaatcctcgtcaccgaaggtgtccggggcgacggtggcgtgctgctcaactcc
gaggggcgccgcttcatgttcgactacatcccaccggtcttcgccgccgagaccgccgac
tccgaggaggaggccgaccgctggtacacggacaagaagaccgcccgccggccgccggaa
ctgctcccccgcgacgaggtggcgcgggccatcaacgccgagatcaaggccggccgcggc
tcaccgcacggcggggtccatctcgacatcgcctcgcgccgcgacccggagtacatccgc
cgccggctgccgtcgatgtaccaccagttcaccgaactcgccgacgtcgacatcacccgg
gagccgatggaggtcggcccgacctgccactacgtcatgggtggcatcaaggtcgacccg
tcgaccgccgcggcgaccgtgcctgggctgttcgccgcgggcgagtgcgccgccggcatg
cacggctccaaccggctcggcggcaactccctgtccgacctgctggtcttcggacggcgg
gcaggactgcacgcggcccgttacgcccagtcgctaccggcgcgcaagcgggccgtggcc
gacgacgcgcagatcgacgcgacggccgcggcggccctcgcgcccttcgcggcggccctc
accccgggctccgtgcaggccggcaccgcctccgccgagggcaccgccagctccgccagg
ggcaccacctccgccagggacagcgccaggaccagcgtctcgccgtcccatccgccggaa
aacccctaccagctccagaacgacctccaggacgtgatgcaacgcctggtcgggatcatc
cggaccgagtccgagctggtccgggcgctcaaggagatcgagacgctacgctcccgcgcg
cggcacgtcgcggtcgtcgggcaccgccagtacaacccgggctggcatctcgccctcgac
ctgggatcgctgctcaccgtcgcggagtgcatcaccacggccgcgctggcccgccgggaa
agccgcggcgggcacacccgcgacgactacccgtccgcggacccggcgttcgcgacgctg
aaccacgtgctccggctgcgcgacgggcggctcgtgctcaccaccgagcccctgcccgcg
atgccaccggagctggccgcattgttcgaggatgccggcgcggaatcccgggcggatcgg
ggcgcaccggccggtgggaagggctcctga

DBGET integrated database retrieval system