KEGG   Frankia symbiont: FsymDg_3231Help
Entry
FsymDg_3231       CDS       T01530                                 

Definition
(GenBank) Glutamate-ammonia-ligase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
fsy  Frankia symbiont
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FsymDg_3231
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     FsymDg_3231
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     FsymDg_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C
Motif
Other DBs
NCBI-ProteinID: AEH10537
UniProt: F8AZ69
LinkDB All DBs
Position
complement(3825941..3829126)
Genome map
AA seq 1061 aa AA seqDB search
MGDVSRTGVARVPGDLGSIGSTHPRGSSVQAQLARMGFTNVDRFAVTVRRLGLVDHDDER
PSGAAGAAGAATPSGDLYDNALLAELARAANPDLALAALERIVETAPADVGRDLLTVLGT
RPGLRTRLVAVLGASAALGDHLVRHPTDWRVLADDDLMRTPPDADLTRARLLRAVGAGPD
MPLPRAAGDSTEVLDALRVAYRRSLMILAARDLTGAVSLDDATAELADLAAAALDAALAV
ARSALSPSAPPARLAVVGMGKCGGRELNYVSDVDVLFVAEPGDDGRPATTSAARTAALGT
ATSLAVGMVRACGAVTGEGTLFQVDVGLRPEGRDGPLVRTLASHDAYYRRWARTWEFQAL
LKARPIAGDREVGEQLCAAVRPLVWSAASRPGFVADVRAMRRRVERSLPRADADRDLKLG
PGGLRDVEFAVQLLQLVHGRADPTLRAVSTLPALDALARGGYVGRRDAAGLADAYRFLRG
TEHRLQLQRLRRVHTLPRDPAEMRWLARSLGFATAERMEAEHARVARFVRRLHERLFYQP
LLEAVARLSAEEVRLTPAEARDRLAALGFADTGRALRHIEALTSGVSRTATIQRRLLPAM
LHWFADAADPDAGLLAYRRVSEALGHTPWYLRLLRDEGGAAERLARLLAASTYVADLMQH
APESVRLLRTIDDLRPSGREQLVRVLIAIARRNPAREQAVGRARAVRRVELVRVACADLL
GLLDVAAVGQALSDAAAATIEAALFVAQRRFEQETGRPLPVRIAVIAMGRLGGEELSYGS
DADVVFVHEPVDDSRGSLTDSEVAAAAGSVVAELLRLLALPAGADPPLVLDAQLRPEGRA
GPMTRTLASYAAYFNRWSQGWEAQALLRARPVAGDAALGERFCAWVDGIRYPPALRPGVV
AELVRLRGRMEAERIPSGVDHTLHLKLGPGGLADVEWAVQVLQLRHAHRVPALRTTSTLA
GLRAAVSAGLLDPAEAATLTQAWTTASRIRNAIMLARGRPGDVLPRQPRALAQVAGALGR
PADQTETLMGDYRRGGAHARAVVEAVFARELDNGYPAGADG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacgtttcccggaccggggtggcacgggtgcccggcgacctcggcagcatcggc
agcacacacccgcggggcagctccgtgcaggcgcaactggcccggatgggcttcaccaac
gtggacaggttcgccgtcacggtccgccggctcggcctggtcgaccacgacgacgagcgt
ccgtccggtgccgccggtgccgccggtgccgccacgccgtccggcgatctttacgacaac
gccctgctggcggaactcgccagggccgccaatcccgacctcgcgctcgcggcgctcgaa
cggatcgtggagaccgcgccagccgatgtcggacgtgacctgctcaccgtcctgggcacc
cggcccggcctgcgcacccggctggtggcggtgctcggggcgagcgccgccctcggcgac
catctggtccggcatcccaccgactggcgggtgctcgccgacgacgacctgatgcggacg
ccaccggacgccgacctgacgcgggcgcggctgctgcgcgcggtcggggcgggcccggac
atgccgctgccccgggccgccggcgacagcaccgaggtcctcgacgcgttacgggtcgcc
taccgccgatccctcatgatcctggctgcgcgcgacctgaccggcgcggtgtccctcgac
gacgccaccgcggagctggccgacctggcggcggccgcgctggacgcggcgctcgcggtc
gcgcgctcggcgctgtcaccgtcggcgccgccggcccgactggcagtcgtcggcatgggc
aagtgcggcggccgggagctgaactacgtcagcgacgtcgacgtgctgttcgtggccgag
cccggtgacgacggccggccggccacgaccagcgccgcgcggaccgccgcgctgggcacg
gcgacatccctggccgtgggcatggtccgggcctgcggggcggtcaccggcgaggggacg
ctgttccaggtcgacgtggggctacggccggaggggcgcgacggcccgctggtgcggacc
ctggccagccacgacgcctactaccggcgctgggcgcggacctgggagttccaggcgctg
ctgaaggcccgcccgatcgccggcgaccgggaggtgggagaacagctgtgcgccgcggtg
cggccgctggtctggtcggcggcctcccggcccggtttcgtcgccgacgtgcgcgcgatg
cgccgccgggtggaacgctccctgcccagagcggacgccgaccgtgatctcaagctcggc
cccggcgggctgcgcgacgtcgagttcgccgtccagttgctccagctggtgcacggccgg
gccgacccgacgctgcgtgccgtctcgacgctgcccgcgctcgacgcgctcgcccgcggc
ggctatgtgggacgccgggacgccgccggcctcgccgacgcctaccgcttcctgcgcggt
accgagcaccgcctgcagctgcagcgcctgcgccgggtgcacaccctgccccgggacccg
gccgagatgcgctggctggcccgttccctcgggttcgccaccgccgagcggatggaggcc
gagcacgcccgggtcgcccggttcgtccgccggctgcacgagcggttgttctaccagccg
ctgctggaggcggtggccaggctgtccgcggaggaggtccggctgacaccggcggaggcc
cgcgaccggctggccgccctgggcttcgccgacacggggcgtgcgctgcgtcacatcgag
gcgctgaccagcggtgtcagccggaccgcgacgatccagcgccgcctgctgccggcgatg
ctgcactggttcgctgacgccgccgatcccgacgccggcctgctcgcttaccgccgggtc
agcgaggcgctcgggcacaccccctggtacctgcggctgctgcgggacgagggcggcgcg
gccgagcggctggcccgcctgttggcggcgagcacctacgtcgcggacctgatgcagcac
gccccggagtcggtgcggctgctgcgcaccatcgacgacctgcggcccagcggccgcgag
cagctcgtccgggtgctgatcgcgatcgcccgccgcaacccggcccgggagcaggcggtc
ggacgggcccgcgcggtgcgccgggtcgaactggtccgggtggcctgcgcggacctgctc
gggctgctcgacgtcgccgcggtgggccaggccctgtcggacgccgccgccgcgacgatc
gaggcggccctgttcgtcgcgcaacgccgcttcgagcaggagaccggccggccgctcccg
gtgcggatcgctgtgatcgcgatgggccggctcggcggggaggagctgtcctacggcagt
gacgcggacgtcgtgttcgtccacgagccggtggacgacagcagaggttcgctcacggac
agtgaagtcgctgccgcggcggggtcggtggtggccgaactgctgcggctgctggccctg
ccggctggcgccgacccgccgctcgtcctggacgcgcagctgcgcccggaggggcgggcc
gggccgatgacccgcaccctcgccagctacgccgcctacttcaaccgctggtcgcagggc
tgggaggcacaggcgctgctgcgggcgcgcccggtcgcgggggatgccgccctcggtgag
aggttctgcgcgtgggtggacgggatccgctatccgccggcgctgcggcccggtgtggtc
gccgagctcgtccggttacgcggccggatggaggcggaacgtatcccctcgggcgtggac
cacaccctgcacctcaagctcggcccgggtggtctcgccgacgtggagtgggccgtgcag
gtgctgcagctgcggcacgcccaccgggtgcccgcgctgcgtacgacgtccacgctcgcg
gggctgcgcgcggcggtctcggccgggctgctcgacccggccgaggccgcgacgctcacg
caggcgtggaccacggcgtcccgcatccgtaacgcgatcatgctggcccgggggcgtccc
ggggacgtgctgccccgtcagccgcgggcgttggcccaggtcgccggcgcgctgggccgt
ccggcggaccagaccgagacgctgatgggcgactaccggcgcggtggcgcgcacgctcgc
gcggtggtggaagcggtgttcgcccgcgaactggacaacggctacccggccggcgcggac
gggtag

DBGET integrated database retrieval system