KEGG   Frankia symbiont: FsymDg_3700Help
Entry
FsymDg_3700       CDS       T01530                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fsy  Frankia symbiont
Pathway
fsy00473  D-Alanine metabolism
fsy00550  Peptidoglycan biosynthesis
fsy01100  Metabolic pathways
fsy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    FsymDg_3700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FsymDg_3700
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    FsymDg_3700
Enzymes [BR:fsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FsymDg_3700
Peptidoglycan biosynthesis and degradation proteins [BR:fsy01011]
 Precursor biosynthesis
  Amino acid ligase
   FsymDg_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEH10977
UniProt: F8AVM7
LinkDB All DBs
Position
complement(4348892..4350049)
Genome map
AA seq 385 aa AA seqDB search
MPGSPPRRTRIAVLYGGRSTEHAISCVSAGSVLRALDRRRYDVVAVGITPDGRWVLGPDD
PDALAVRDGVLPAVDATARPVVLPGDPTVGGLIALDGVAVSAGPGPADRGTADLGAVGLG
AVDVVFPLLHGPFGEDGTVQGLLEMAAVPYVGSGVFASAAAMDKQYMKILLAAAGLDIGP
YTVLRAGQALSGDDRERLGLPVFVKPARGGSSIGISRVDAWDDLATALKAARAVDPKVLV
EAAVVGREVECGVLGSLDGGGPEASLPAEVTVASSAGSAGFYDFEAKYLSDAARFDVPAN
LPAEVTAAVRQIAVRAFVALDCAGLARVDVFVRPDGSVVVNEVNTMPGFTPTSMFPRMWA
ATGLDYPRLVDRLVALATRHGTGLH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctctccgccgcgccggacccggatcgccgtcctgtacggcggccgcagcacc
gagcacgcgatctcctgtgtctcggctggcagcgtcctgcgagccctggaccggcggcgt
tatgacgttgtcgctgtcggtatcacccccgatggccgatgggtactcggcccggacgat
ccggacgcgctcgccgtccgcgacggcgtgctgcccgcggtcgacgccaccgccaggccg
gtggtgctgccaggtgaccccaccgtgggcggcctgatagcgctcgacggggtggcggtc
tcggcgggccccggccccgccgaccgcggtaccgccgaccttggcgccgttggccttggc
gccgtcgacgtggtgttcccgctgctgcacgggccgtttggtgaggacggcaccgtgcag
gggctgctggagatggccgccgtcccctacgtcggctccggggtgttcgccagcgccgcg
gccatggacaagcagtacatgaagatcctgctcgccgccgccgggctcgacatcggcccg
tacacggtgctgcgcgccgggcaggccctgagcggtgacgaccgcgaacgcctcggcctg
cccgtgttcgtcaaaccggcccggggcgggtcgagcatcggcatcagccgggtggacgcc
tgggacgacctggcgaccgcgctgaaggccgcccgcgccgtcgatccgaaggtgctggtc
gaggccgccgtcgtcggccgtgaggtcgagtgcggcgtgctcggcagcctcgacggcggc
gggccggaggcgagcctgcccgcggaggtgacggtggcctcgtccgcggggtccgcgggc
ttctacgacttcgaggccaagtacctttcggacgcggcccgcttcgacgtcccggcgaac
ctgcccgccgaggtcaccgccgcggtccgtcagatcgccgtgcgggcgttcgtcgcgctg
gactgcgcgggcctcgcccgggtggacgtgttcgtccgcccggacggctcggtcgtcgtc
aacgaggtgaacaccatgccggggttcaccccgacctcgatgttcccgcggatgtgggcc
gccaccggcctggactatccgcggttggtggaccggttggtcgcgctggcgacccgtcac
ggcacggggctgcactga

DBGET integrated database retrieval system