KEGG   Francisella tularensis subsp. novicida F6168: AS84_1462Help
Entry
AS84_1462         CDS       T03873                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ftd  Francisella tularensis subsp. novicida F6168
Pathway
ftd00240  Pyrimidine metabolism
ftd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AS84_1462
Enzymes [BR:ftd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AS84_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FAD_binding_4 AAA_22 ResIII AAA_30
Motif
Other DBs
NCBI-ProteinID: AJI45393
LinkDB All DBs
Position
1512969..1513562
Genome map
AA seq 197 aa AA seqDB search
MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGIDQDAY
SLTDRDNIFEFVENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIVDELNIPVICYGLRTNY
LGQPFETAALLLAIADTLEEVKTICHCGKKASFNMMVQNGKAIKQGNPIVVDDDSLKEID
TKYVSVCRKHWKEGVYE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaattatattttagatattcggctatggatgctggtaagacactagatctttta
aaagttgcttataactatgaagatagaggtaggaagcccttagtattaacatcagcgatt
gataaaagagcgggtttaaataaagttaaatcacggataggtatagaccaggatgcttac
tcactgactgatagagataatatttttgaatttgtcgaaaattataatagtagtaacaag
atagattgtgtattgatagatgaaattcatttttttactcaagagcaagtttggcaatta
gcagagattgttgatgaactaaatattcctgtgatttgctatgggttacgtactaattac
ttaggtcagccatttgagacagcagcgttacttttggctattgctgatactcttgaagaa
gtcaaaacaatttgtcactgcggtaaaaaagcaagctttaatatgatggtgcagaatggt
aaagcaataaaacaaggtaatcccatagtggttgatgatgattcgcttaaagagatagat
accaaatatgtctctgtatgtcgtaagcactggaaagaaggcgtgtatgaataa

DBGET integrated database retrieval system