KEGG   Francisella tularensis subsp. novicida F6168: AS84_1675Help
Entry
AS84_1675         CDS       T03873                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ftd  Francisella tularensis subsp. novicida F6168
Pathway
ftd00550  Peptidoglycan biosynthesis
ftd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AS84_1675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ftd01002]
    AS84_1675
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ftd01011]
    AS84_1675
Enzymes [BR:ftd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AS84_1675
Peptidases [BR:ftd01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AS84_1675
Peptidoglycan biosynthesis and degradation proteins [BR:ftd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AS84_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJI45675
LinkDB All DBs
Structure
PDB: 

Position
1725475..1726809
Genome map
AA seq 444 aa AA seqDB search
MKLTKIALLTASITAGVAFAAPNISAGSDPYFNGANGLAQKDIIIRPANIELDAPAWVAM
DYRTGDIVSEKNMDVRRAPASLTKIMTSYIVASEIKAGNLSWDTMIPISENAASTGGSKM
YVKAGAKVSVRNLVTGMDVVSGNDATIALAEYIGGTTQAFTDLMNQTAKAIGMNNTHFAN
PDGLPGGEQYTTAHDMALLARSYIYNFPEAYKVYDDKGLVWNATKQDSVSIADRKQCLPK
FDRATGNVIESYTVKGLDDQAKDKCNKLFPKGDNFVLQNNRNRLLFTFDGADGMKTGHTD
AAGYCLVSSAKQDGERFISVVLGTTSSAKRDSESAKLLRYALSKYENVLLYKANSPVTIS
ADNIPNAKAGQKLTVASNQNIYKTVPKTYVPYLKQGIEFNPNLKAPIKTGQTVGNLVITL
GDTKEEIASIPVVAMNNVSQKGWW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacaaaaatagctttattaacagctagtataacagcgggggtagcttttgct
gcgcctaatatatctgccggctctgatccttatttcaatggagctaatggacttgcacag
aaagatattattataagacctgcaaacattgagctagatgctccagcttgggtagcgatg
gattatcgtactggagatattgttagtgaaaaaaatatggatgtgagaagagctcctgca
agcttaactaaaatcatgacttcctatatagttgctagtgaaataaaagctggtaatcta
agctgggatacaatgatcccaattagtgaaaatgctgcttctacaggtggctcaaagatg
tatgttaaagccggtgctaaggtatctgtaagaaatcttgtaactggtatggatgtagtg
tctggtaatgacgccactattgctcttgctgaatatatcggcggaactacacaagccttt
actgatttaatgaatcaaacagcaaaggctattggtatgaataatactcattttgctaat
ccagatggacttccaggtggtgagcaatatactactgctcatgatatggcgttgcttgca
agatcatacatatataatttcccagaagcatataaagtatacgatgataagggcttagtt
tggaatgccacaaaacaagactccgtaagtattgctgatcgtaaacagtgcttacctaag
tttgatcgcgctactggaaatgtcatagagagctatacggtcaaaggtcttgatgatcaa
gctaaagataaatgtaataagcttttccctaaaggtgataatttcgtattacaaaataat
agaaataggttactatttacatttgatggggctgatggtatgaagactggtcatactgat
gcagctggatactgtctagtttcatctgctaaacaagatggcgagagatttatttctgta
gttcttggtactactagttctgctaagagagattcagaatcagctaaattactaagatat
gctctgagtaagtatgaaaatgtacttttatacaaagcaaattctccagttacaattagt
gctgataatatccctaatgcaaaagctggacaaaagttaactgtagcttcaaatcaaaat
atttataaaacagtacctaaaacttatgtcccttatctaaagcaaggtatagagtttaat
ccaaatttgaaagctcctattaaaacaggtcaaactgtaggtaatttagtgattactcta
ggtgatactaaggaggaaattgctagtatacctgtagttgctatgaataatgtttcacaa
aaaggttggtggtaa

DBGET integrated database retrieval system