KEGG   Francisella tularensis subsp. novicida F6168: AS84_787Help
Entry
AS84_787          CDS       T03873                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftd  Francisella tularensis subsp. novicida F6168
Pathway
ftd00250  Alanine, aspartate and glutamate metabolism
ftd00410  beta-Alanine metabolism
ftd00430  Taurine and hypotaurine metabolism
ftd00650  Butanoate metabolism
ftd01100  Metabolic pathways
ftd01110  Biosynthesis of secondary metabolites
ftd01120  Microbial metabolism in diverse environments
ftd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS84_787
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS84_787
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS84_787
   00430 Taurine and hypotaurine metabolism
    AS84_787
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AS84_787
Enzymes [BR:ftd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AS84_787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI44801
LinkDB All DBs
Position
808112..809458
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPTNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVINSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttggcgacgttttgccaaactgaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggcatggcaatgaagtggcgttggcgagataaaatgaaagctcaaggtaaa
gattatacaaaacctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcaaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttggg
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcaccacttggggttggttgggttatttgggct
gataaaaagtacttgccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcactgaatttctcgcgacctggtggtcagatagtagcccagtattataat
tttgttaggttaggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaccaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattaattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system