KEGG   Fluviicola taffensis: Fluta_0207Help
Entry
Fluta_0207        CDS       T01455                                 

Definition
(GenBank) amino acid/polyamine/organocation transporter, APC superfamily
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
fte  Fluviicola taffensis
Brite
KEGG Orthology (KO) [BR:fte00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Fluta_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AEA42216
UniProt: F2IBY8
LinkDB All DBs
Position
complement(210246..211853)
Genome map
AA seq 535 aa AA seqDB search
MSNIFKKKSISLLLKDAAANEGGLKKTLGVWSLIALGIGAIIGAGLFVRTAAAAGEAAGS
GVTLSFALAAIGCAFAGLCYAEFASTIPIAGSAYTYSYATLGEIVAWIIGWALLMEYALG
AATVSIAWSEYLNNLLGGAIPYEWCHSPFEHVNKLIGTENITLLTKELAMTAKNGVVILS
DGELAKLAPEVKGLVQTTSGYLNAPALAILFLVTLLLIKGTQESAFINGIMVFLKVAIVL
VFIFLGWQFINPANHTPYLIPEGVENHEGIFQHGWGGIVGGAAIVFFAFIGFDAVSTAAQ
EAKNPKRDMPIGILGSLVICTILYILFAHVLTGVAPWEEYEKAGKEASVAYAVNTYMPGY
GWLATSITIAILAGFSSVILVMLMGQSRVFYSMSKDGLIPKVFSDLHPKFKTPYKSNIIL
FVLVGLFAAFVPGSVAGDLTSFGTLFAFVIVCAGIIVMRKKFPNLERPFKTPLVPLVPIL
GILVCTFMIVALDLTTLTVAGIWMFVGFLIYFTYGKRNSKIDQEQERENKMDNPE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatattttcaaaaagaaatcgatttcattattattaaaagatgcggctgcaaac
gaaggcggattaaagaaaacgctgggagtgtggtccttgattgcattaggaattggagca
attatcggggctggattatttgtaagaactgctgctgctgctggtgaagctgcggggtca
ggagtaactttatcttttgctttagcggcaattggttgtgcttttgcaggtctgtgttat
gcggaatttgcttctactattccaattgctggtagcgcttatacttattcgtatgcaaca
ttaggtgaaattgtagcatggattattggttgggcacttttgatggaatatgcattgggt
gctgcaacagtttcgatagcctggagcgaatatctcaataatttgctcggaggagccata
ccctatgaatggtgtcattcgccattcgaacatgtaaacaagttaatcggaactgaaaat
attacactattaaccaaagaattggcgatgacagcgaagaatggagttgtgattctttca
gatggtgagttagctaaattagctcctgaagttaaaggtttagttcagactacttcaggt
tatttgaatgctcctgcattggctattttattcttagtgactttattattaattaaagga
actcaagaatctgcatttattaatggaatcatggttttcttaaaagttgctattgtattg
gtattcatatttttagggtggcaatttattaatccagctaatcatacaccttatttaatt
cctgaaggagttgaaaatcatgaaggtattttccaacatggttggggaggtattgttggt
ggtgctgcaattgtattctttgcatttattggatttgatgccgtttctacggctgctcag
gaagcaaaaaacccgaaacgggatatgccgatcggaattttgggatccttagtgatttgt
acaattctctatattctttttgctcacgtacttacaggtgttgctccatgggaagagtat
gaaaaagcaggtaaagaagcttccgttgcttatgcagttaatacatatatgcctggatac
ggttggttggcaacaagtatcacaattgcaattttagcaggattctcttctgtaatttta
gtgatgttgatgggacaatctcgtgtgttttattcgatgtctaaagatggattgattcct
aaagtgttttctgatttgcacccgaaatttaaaacaccctataaatcaaatattattttg
tttgtattggtagggttatttgctgcgtttgtcccaggaagtgtcgctggtgatttaaca
tcattcggaaccttattcgcgttcgttatcgtttgtgcaggtattattgtcatgcgtaaa
aaattcccaaatttggaacgtccctttaaaacacctttggttccactggttcctatttta
ggaattttagtgtgtacatttatgattgtagcattagacttaacaacactaactgttgct
ggaatttggatgtttgtaggcttcttgatttattttacatacggtaaacgtaatagtaaa
atcgatcaagaacaagaacgagaaaataaaatggataatccagaataa

DBGET integrated database retrieval system