KEGG   Fluviicola taffensis: Fluta_1283Help
Entry
Fluta_1283        CDS       T01455                                 

Definition
(GenBank) L-aminoadipate-semialdehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fte  Fluviicola taffensis
Pathway
fte00010  Glycolysis / Gluconeogenesis
fte00053  Ascorbate and aldarate metabolism
fte00071  Fatty acid degradation
fte00280  Valine, leucine and isoleucine degradation
fte00310  Lysine degradation
fte00330  Arginine and proline metabolism
fte00340  Histidine metabolism
fte00380  Tryptophan metabolism
fte00410  beta-Alanine metabolism
fte00561  Glycerolipid metabolism
fte00620  Pyruvate metabolism
fte00625  Chloroalkane and chloroalkene degradation
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fluta_1283
   00053 Ascorbate and aldarate metabolism
    Fluta_1283
   00620 Pyruvate metabolism
    Fluta_1283
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Fluta_1283
   00561 Glycerolipid metabolism
    Fluta_1283
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fluta_1283
   00310 Lysine degradation
    Fluta_1283
   00330 Arginine and proline metabolism
    Fluta_1283
   00340 Histidine metabolism
    Fluta_1283
   00380 Tryptophan metabolism
    Fluta_1283
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Fluta_1283
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Fluta_1283
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fluta_1283
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Fluta_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEA43278
UniProt: F2IC52
LinkDB All DBs
Position
1445566..1447122
Genome map
AA seq 518 aa AA seqDB search
MSATATDLGIQETLKTLGIEAVNRGASTGGYWFNTRGAQIDSVSPVDGKIIASVSSATET
EYEAIVLKAQEAYHYWRMVPAPKRGEVVRQLAEKIREKKQALGELVSYEMGKSLQEGLGE
VQEMIDICDFAVGLSRQLYGLTMHSERAGHRMYEQYHPLGIVGIISAFNFPVAVWNWNTA
LAWVCGDVCIWKPSEKTPLTAIACQKLTQEVFEANGVPEGVSCLLIGDAEIGKLMSNDTR
IPLISATGSTRMGKLVGEAVGKRLGRHLLELGGNNAVIITESADLKIVVPGAVFGAVGTA
GQRCTSTRRLIIHESVYDKVRDAVVNAYGQLKIGNPLDQNNHVGPLIDKDAVKAYQNALI
QVVEEGGKILVEGGVLSGEGYESGCYVKPAIAEAQNTFKIVQHETFAPVLYLMKYSGGVE
NAIAVQNGVPQGLSSAIMTNNLREAEAFLSQAGSDCGIANVNIGTSGAEIGGAFGGEKET
GGGRESGSDAWKVYMRRQTNTINYTDSLPLAQGIKFDL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaacagcaacagatcttggaatacaagaaacattaaaaacattgggaatcgaa
gcggtaaaccgtggagcttcaacaggaggatattggtttaacacacgtggagcgcaaatc
gattcagtttcgccagtagatggaaaaataattgcatctgtttcttccgcaacagaaaca
gaatacgaagcaatcgtattaaaagcacaagaagcatatcactattggagaatggttcct
gcaccaaagcgtggagaagttgttcgccaattggcagaaaaaatccgtgagaaaaaacaa
gctcttggagaattggtttcttatgaaatggggaaatcattgcaagaaggcttgggtgaa
gttcaagaaatgatcgacatctgtgactttgcagttggactttctcggcaattgtacggt
ttaacgatgcactctgaacgcgctggacatagaatgtacgaacaataccacccattagga
atcgtaggaattatttctgcattcaacttcccagttgcggtttggaattggaacacagct
ttggcttgggtatgtggagacgtttgtatttggaaaccatccgaaaaaacgcctttaaca
gcaatcgcttgccagaaattgacacaagaagttttcgaagcaaacggagttcctgaagga
gtttcttgtttgttaatcggagatgctgaaatcggaaaattaatgtcgaacgacacacgc
attccattgatttctgcaacaggttctactcgcatgggtaaattggttggtgaagcagtt
ggaaaacgtttgggtcgtcatttattggaactaggtggaaacaacgccgtaatcattaca
gaaagcgctgacttgaaaattgtagtaccaggtgctgtatttggtgcagttggaacagca
ggtcaacgttgtacttctactcgtcgtttgattattcacgaatctgtttatgataaagta
agagatgcggtcgtaaacgcttacggacagttgaaaattgggaatccattggatcaaaac
aatcacgttggaccacttatcgataaagatgcagtaaaagcttatcaaaacgcgttgatt
caagttgttgaagaaggcggtaaaatattggttgaaggaggagttctttctggtgaagga
tatgaatctggatgttatgtaaaaccagcaattgcagaagctcaaaacacctttaaaatt
gttcagcacgaaacatttgctcctgtattgtatttgatgaaatactcaggtggtgtagaa
aatgcaatcgctgttcaaaacggagttccacaaggattatcttcagcaattatgacgaat
aacttgcgtgaagcagaagcattcttgtctcaagcaggttctgattgtggaattgcaaat
gtaaatatcggtacatcaggtgctgagattggtggagctttcggtggtgaaaaagaaact
ggaggtggccgtgaatctggttctgatgcatggaaagtatatatgcgtcgtcagaccaac
acgatcaactacacagattcattgccattggcacaaggaatcaaatttgatttgtaa

DBGET integrated database retrieval system