KEGG   Fluviicola taffensis: Fluta_1299Help
Entry
Fluta_1299        CDS       T01455                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fte  Fluviicola taffensis
Pathway
fte00020  Citrate cycle (TCA cycle)
fte00310  Lysine degradation
fte00380  Tryptophan metabolism
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
fte01200  Carbon metabolism
Module
fte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fluta_1299
  09105 Amino acid metabolism
   00310 Lysine degradation
    Fluta_1299
   00380 Tryptophan metabolism
    Fluta_1299
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Fluta_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEA43294
UniProt: F2IC68
LinkDB All DBs
Position
1463109..1465832
Genome map
AA seq 907 aa AA seqDB search
MDKVTYVGNADVNAIEHLYQSYSKDPESVDVSWQKFFEGFDFARTNFEDGSEIPENFQKE
FKVINLIHGYRTRGHLFTKTNPVRERRKYEPTLAIENFGLEASDLDTVFQAGEQIGIGAA
TLRDIILDLEQCYCQSIGIEYMFMREPERLEWFRNSIEVKNRPKFDVARKKHIYKKLVQT
SNFEAFLGKKYVGQKRFSIEGGEALIPALDALVEKGSSLGVEYFVMGMAHRGRLNTLTNI
FQKRPQDIFSEFEGKEFDYDGAFDGDVKYHQGFTSSVTTESGKEVGLTLAPNPSHLEAVD
PVVQGIARAKLDNHFQDENKVCPVMIHGDAAVAGQGIVYEVIQMALLDGYRAGGTIHVVV
NNQVGFTTNFHDARSSTYCTDVAKTTLTPVFHVNGDDIEAVIQTMEIAMEYRQKFHRDVF
IDLLCYRKYGHNEGDEPKFTQPNLYNIIAKHPNPKDIYLKQLLAEGSLSAETAKTIEDEY
NAHLESEFETARKNEKAVVWDFLSKTWEGFRHSKSADFDSSPETGVKKERLLELGKKLAT
LPEGKKYFRKIQKIFDDRLAAVETNNLDWGTAEMLAYATLLDEGTPVRISGQDVERGTFS
HRHAVVKTEDTEEEIETLNMLSEKQAAFTIYNSLLSEYAVLGFEYGYSLAAPKGLTIWEA
QFGDFFNGAQIMIDQFITAGEDKWSTQSGLVMLLPHGYEGQGAEHSSGRIERWLQQCADD
NIQVVNTSTPANHFHLLRRQLIRPFRKPLVVFSPKLLLRYPAATSTLEEMASGNFQEVID
DSSAKVGQVDTLVFCSGKFYYEMKEKALEMGADNMAFVRIEQLYPLPQKQIDAIVAKYNA
KNVIWAQEEPENMGAWTYIAMNLRHIPFVGITRPASAAAAEGSKKLHERRLKQLYADIFK
YASVPVK
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtgacgtacgtcggaaatgcagatgtaaatgcgatagagcatttgtatcag
tcatacagtaaagaccctgaaagcgtagatgttagctggcaaaaattctttgaaggattt
gattttgctcgaactaacttcgaagatggaagtgaaattcctgaaaattttcagaaagaa
ttcaaagtaattaatttgattcacgggtatcgaactcgcggacatttatttacaaaaaca
aaccctgttcgcgaacgtcgaaaatacgagccaactttagccattgaaaactttggttta
gaggcttccgatttggatacggtatttcaagcaggagaacaaattggtattggtgcggca
acattgcgggacattattctagatttagagcaatgttactgccaatcaattggtatcgaa
tacatgtttatgcgtgagccagagcgtttggaatggttcagaaacagcatagaagtaaaa
aatcgaccaaaatttgatgtagcacgtaaaaagcatatctataaaaaactcgttcagact
tccaattttgaagcctttttagggaaaaaatacgttggtcaaaagcgtttctctattgaa
ggtggcgaggctttgattcctgccttagatgcgttagtagaaaaaggttctagcttagga
gttgaatattttgtaatgggaatggctcatcgtggtcgtttgaataccctaacaaatatc
ttccaaaaaagaccacaagatatcttctccgaatttgaaggaaaagaatttgattacgat
ggtgcatttgacggagacgtaaaataccatcaagggtttactagttctgtaacaactgaa
tctggaaaagaagtaggattaacacttgctccaaacccttctcacttagaagccgtagat
ccagttgttcaaggtattgcacgcgcaaaattggataatcatttccaagacgaaaacaaa
gtttgtccggtaatgattcatggagatgctgctgttgctggtcaaggtattgtttacgag
gtgatacaaatggctttgttggatggatatcgtgctggtgggacaattcacgtagtggtt
aataaccaagttggatttacaacaaatttccacgatgcgcgctcatcaacttattgtacg
gacgttgcaaaaacaacattgactccagtttttcatgtaaatggcgacgatattgaggca
gttattcaaaccatggaaattgccatggagtaccgccaaaaattccaccgagatgtattc
atagatttattatgttaccgcaaatacggacacaatgaaggagatgagcctaaattcacg
caaccgaatttatataatatcatcgcgaaacatccaaatccgaaagatatttatttgaag
caattattagctgaagggtcactttctgctgaaactgcaaaaacaatagaagacgaatac
aatgctcatttggaaagcgagttcgaaacagcgcgtaagaatgaaaaagcagtcgtttgg
gatttcttaagtaaaacttgggaaggcttccgccatagcaaatcagctgattttgattca
agtcctgagactggagttaaaaaagagcgtttgctagagttggggaaaaaattagcaact
ttacctgaaggcaaaaaatattttcgtaaaattcaaaagatttttgacgaccgtttagcg
gctgttgaaacgaataatttggattggggaacagcagaaatgttggcttatgctacactt
ctggacgaaggaacccctgttcgtatttctggtcaagatgtagaacgcggaacgttttct
caccgtcatgctgttgtaaaaacagaagatacggaagaggaaatcgaaaccttgaacatg
ctttcggaaaaacaagcagcgtttacaatttacaattcattattgtcagaatatgcagtt
cttggatttgaatatggatattcattagctgcaccaaaaggattaacgatttgggaagca
caatttggagatttcttcaatggtgctcaaattatgattgatcaatttattacagctggt
gaagataaatggtctactcaaagtggattggtaatgcttcttcctcatggatatgaaggt
caaggtgcagagcattcaagcggaagaatagaacgttggttacaacaatgtgcagatgat
aatattcaggttgtgaatacttctactcctgcaaatcattttcacttgcttcgccgtcaa
ttgattcgcccattccgcaaaccattggtggtattttctcctaaattattattgcgctat
ccagctgctacttcaactttagaagaaatggccagtggtaacttccaagaagtaatcgat
gactctagcgcaaaagttggtcaagtagatacacttgttttctgctcagggaaattctat
tacgaaatgaaagaaaaagctcttgaaatgggtgcagataacatggcatttgttcgtatc
gagcaattgtatcctttacctcaaaagcaaatcgatgctattgttgcaaaatacaacgca
aagaatgttatttgggcacaagaagagccagaaaatatgggtgcttggacttacattgca
atgaatttaagacacattccatttgttggaatcacaagaccagcatctgcggctgcggcc
gaaggttccaaaaaattgcacgaacgtcgtttgaaacaattgtatgcagatatatttaaa
tatgcatctgttccagtaaaataa

DBGET integrated database retrieval system