KEGG   Fluviicola taffensis: Fluta_1605Help
Entry
Fluta_1605        CDS       T01455                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fte  Fluviicola taffensis
Pathway
fte00380  Tryptophan metabolism
fte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Fluta_1605
Enzymes [BR:fte01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Fluta_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEA43597
UniProt: F2IFX6
LinkDB All DBs
Position
1836224..1837507
Genome map
AA seq 427 aa AA seqDB search
MKYEFTPEFAAQMDASDALKSYRDRFHFPTFTKNPVRYFTGNSLGLQPKTVREKVNLELD
DWAKWGVEGHFLGTNPWYKYHEFLTESSAKIVGALPKEVVVTHSLTTNLHLLMVSFYQPK
GTRTKILCEAKAFPSDLYALESQVRFHGLNPETDLVGMSPRAGEHTLRDEDILAKILELG
DSLALVMFGGVNYYTGQLLDMESITKAGKGVGAMVGFDLAHAAGNIPVKLHDWGVDFAAW
CSYKYLNSSPGGVSGMFVHEKHANNNSLPRFAGWWGYDKSTRFQMEPGFVPMEGAEGWQL
SNAPILGMAAHWASLEIFDEVGMDQLKAKSDILTAYLEFILDGLSAKHPSKCRFEIITPR
EPKRRGAQLSILVHGKGKQIFDAISEKGVVADWREPNVIRVAPVPLYNSFEDVYFLGKYL
EEAIIEQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaatttactcccgagtttgcagctcaaatggatgcttcagacgcgttaaag
tcttacagagaccgcttccattttccaactttcactaagaatcctgtgagatatttcaca
ggaaactcgttaggcctacagccaaaaacagtgcgtgaaaaagtaaaccttgaattggat
gactgggcgaaatggggagtagagggccattttttaggaacaaatccgtggtataagtat
catgaattcttaaccgaatcttctgcaaaaatcgtaggagcattgcctaaagaagtggta
gttacgcattctttgacgacgaatctgcacttactaatggtttcgttttatcaaccaaaa
ggaacacgaacaaaaattctgtgtgaagcaaaagcatttccaagtgatttgtatgcattg
gaatcacaagtgcgttttcatgggttaaatccagaaactgatttagtaggaatgagtccg
cgagcaggagaacatactttgcgcgatgaagatattttggccaaaattttagagctggga
gattctttggctttagttatgtttggcggagtgaattattatacgggccaacttttggat
atggaatcaataaccaaagcgggtaaaggagttggtgcaatggttggatttgacttggcg
cacgctgctggaaatattccggtgaaactgcacgattggggagttgatttcgccgcttgg
tgttcgtataaatatttgaactcaagtcctggaggagtttcagggatgtttgttcacgaa
aaacatgcaaataataattcacttcctcgttttgcaggatggtggggatacgataaaagc
acacgttttcaaatggaacctggttttgttccaatggaaggtgctgaaggctggcagttg
agtaatgcgcctattttaggaatggctgctcattgggcatcattggaaatttttgatgag
gttggaatggatcaactaaaggcaaaaagtgatattttgactgcctatttggagttcatc
ttggatggattatccgcgaaacatccgtctaaatgccgctttgaaatcattacgccaaga
gaaccaaaacgtagaggagcacagttgtcaatcttagttcacggaaaaggaaaacaaata
ttcgatgcgatttctgaaaaaggagtagttgctgattggagagaaccaaatgtaattcgc
gtggcacccgttccattatataattcctttgaggatgtttatttccttgggaagtatttg
gaggaggctattatagaacaatag

DBGET integrated database retrieval system