KEGG   Fluviicola taffensis: Fluta_2153Help
Entry
Fluta_2153        CDS       T01455                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
fte  Fluviicola taffensis
Brite
Translation factors [BR:fte03012]
 Eukaryotic Type
  Elongation factors
   Fluta_2153
 Prokaryotic Type
   Fluta_2153
Mitochondrial biogenesis [BR:fte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Fluta_2153
Exosome [BR:fte04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Fluta_2153
  Exosomal proteins of breast cancer cells
   Fluta_2153
  Exosomal proteins of colorectal cancer cells
   Fluta_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AEA44139
UniProt: F2I9Y1
LinkDB All DBs
Position
2479835..2481025
Genome map
AA seq 396 aa AA seqDB search
MAKENFNRSKPHVNIGTIGHVDHGKTTLTAAISSVLASKGLAAVRDFSSIDNAPEEKERG
ITINTSHIEYETLNRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGKQVGVPRLVVFMNKVDMVDDAELLELVEMEVRELLSFYDYDGDNAPVIQGSALGALN
GEAEWVAKIDELMDAVDTYIELPPRDVDKPFLMPVEDVFTITGRGTVATGRIETGVINSG
DPVEILGMGEEKLTSTVTGVEMFRKILDRGEAGDNVGLLLRGIEKSQIKRGMVICKPGSV
KPHADFKAEIYVLKKEEGGRHTPFHNRYRPQFYFRTTDVTGEIFLTDGREMVMPGDNVTI
TVKLIVPVAMDKGLRFAIREGGRTVGAGQVTELISA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaattttaatcgttccaaaccgcacgttaacatcgggactatcgggcac
gttgaccatggtaagactacgttaacagctgcaatctctagcgtgttagcttctaaggga
ttggctgcggttcgtgatttctcttctattgacaacgctcctgaagaaaaagagcgtggt
attactattaacacatcacacatcgagtacgaaactcttaaccgtcactacgcacacgtt
gactgtccaggtcacgcggattacgtaaagaacatggttactggtgctgctcagatggat
ggtgctatcttggttgttgctgcaactgatggtccaatgcctcaaactcgtgagcatatc
ctattaggaaaacaagttggtgttcctcgtttagttgtattcatgaataaagtggatatg
gttgatgacgctgagttgttagaactagttgaaatggaagttcgtgaattgttgtctttc
tatgactatgatggtgacaatgctccagttattcaaggttctgcattaggtgcattgaac
ggagaagctgagtgggttgctaaaatcgacgaattaatggatgcggttgatacttatatc
gaattgcctccacgtgatgttgataagcctttcttgatgccagttgaagatgtatttacg
attacaggtcgtggtacagtagcaacaggacgtatcgaaacaggtgttattaactctgga
gatccagttgagatcttagggatgggtgaagagaaattgacttctactgtaactggggtt
gagatgttccgcaaaatcttggatagaggtgaagcaggtgacaacgttggtcttttatta
cgtggtattgagaaatctcaaatcaaacgtggaatggtaatctgtaaaccaggttctgtt
aaaccacacgctgatttcaaagctgaaatctacgtattgaaaaaagaagaaggtggacgt
cacactccattccataacagataccgtcctcagttttacttccgtacaactgacgttact
ggagagattttcttgacagacggacgtgagatggttatgccaggtgataacgtaacaatt
actgttaagttgatcgttcctgtagcaatggacaaaggtttacgttttgcaatccgtgag
ggtggtagaactgtaggtgctggtcaagttacagagcttatctcagcttaa

DBGET integrated database retrieval system