KEGG   Fluviicola taffensis: Fluta_2846Help
Entry
Fluta_2846        CDS       T01455                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fte  Fluviicola taffensis
Pathway
fte00970  Aminoacyl-tRNA biosynthesis
fte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Fluta_2846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fte03029]
    Fluta_2846
Enzymes [BR:fte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Fluta_2846
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Fluta_2846
Mitochondrial biogenesis [BR:fte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Fluta_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEA44825
UniProt: F2IHP7
LinkDB All DBs
Position
complement(3274767..3276227)
Genome map
AA seq 486 aa AA seqDB search
MDTEIRDKYEVVIGLEVHAQLLTKTKAYSSDINEYGAAPNTNVSVITLGHPGTLPVMNKK
TIEYAVKLGLALGCTIAEHQHFARKNYFYPDLPKGYQITQDTTPICTGGSIVIKTEDNQE
KTIGLTRIHMEEDAGKSIHDVDLYDTLVDLNRAGTPLLEIVSEPEIRSSQEAYSYLTEVR
RLVRYLDICDGNMEEGSLRCDANVSVRLKGAPEFGTKVEVKNMNSIRNVQRAIEFEVDRQ
IAAVEKGETISQETRSFDALKGITISMRSKEAANDYRYFPEPDLQPIVVDAIYVNQVKSK
MPALPRELHAKYTQDLKLSDYDAGILTDSKSIALFFEEVISNTKNYKSAANWIMGEVKSY
LNQNGLEIEDLPISAKQIAGIINLIESGKVSNSAAAQKLFPALIEKPDSNLEELAISLNI
IQESNTDSLKEVILSVFEQHPSEFSRFKAGENQLTGFFMGQIMKASGGKADPKTTNALLR
ELIQKN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatacagaaataagagataaatacgaagttgttattggattagaggttcacgctcag
ttgctgaccaaaaccaaagcatattcttcggatattaatgaatatggcgctgcgccaaat
acgaatgtgagtgtgattactttgggacatccaggaacattgcctgtgatgaacaaaaaa
acaatcgaatatgcagtaaagctaggtttggctttgggttgtacgattgcggagcaccag
cattttgctcggaaaaattatttctaccccgatcttccgaaaggatatcagattacgcaa
gacactactccaatttgtacaggaggatcaattgtaatcaaaacagaggacaatcaagaa
aaaacaattggtttaacacgcattcacatggaagaagatgctggaaaatcaattcacgat
gttgatttgtacgatactttggtagatttgaatcgcgctggaactccccttttggaaatc
gtttcagaacctgagattcgctctagtcaagaagcttatagctatttgacggaagttcgc
cgtttggttcgttacttggatatttgtgatggaaacatggaagaaggttctttacgctgt
gacgccaatgtatctgttcgattgaaaggcgcaccagaattcggtacgaaggtcgaagta
aaaaacatgaattctattcgtaatgtacaacgtgcgattgaatttgaggttgatcgtcag
attgctgcagttgaaaaaggagaaaccatttcacaagaaacacgcagttttgatgcattg
aagggaattacaatttctatgcgtagcaaagaagctgcaaatgattaccgctactttcct
gagcctgatttacaaccaattgttgtagatgcaatatatgtgaatcaggtaaaatcgaaa
atgccagctcttccaagagaattgcatgcgaaatatacgcaagatttaaagctttctgat
tatgatgcgggaattttgaccgactctaaatccattgccttgttctttgaagaagttatt
tcaaacacaaaaaactacaaatcggcggcaaactggatcatgggcgaagtcaaatcttac
ctcaatcaaaatggtttagaaatagaagatttgccaatttcagcaaaacaaattgctgga
attatcaacttaattgaaagtggaaaagtttccaattctgcagctgctcaaaagctattc
cctgcattgattgaaaaaccagattcgaacttagaagagttggctatctcattaaatatc
attcaggaatccaatactgattcgttaaaagaagttattttgagcgttttcgagcaacat
ccgagcgagttttctcgttttaaagctggagaaaatcaattaactggatttttcatggga
caaatcatgaaagcttctggaggaaaggctgatccaaaaactacaaatgcgctattgcgc
gaattaattcaaaaaaattaa

DBGET integrated database retrieval system