KEGG   Francisella tularensis subsp. tularensis FSC198: FTF1722cHelp
Entry
FTF1722c          CDS       T00381                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00250  Alanine, aspartate and glutamate metabolism
ftf00410  beta-Alanine metabolism
ftf00430  Taurine and hypotaurine metabolism
ftf00650  Butanoate metabolism
ftf01100  Metabolic pathways
ftf01110  Biosynthesis of secondary metabolites
ftf01120  Microbial metabolism in diverse environments
ftf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FTF1722c (gad)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTF1722c (gad)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FTF1722c (gad)
   00430 Taurine and hypotaurine metabolism
    FTF1722c (gad)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FTF1722c (gad)
Enzymes [BR:ftf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FTF1722c (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAL09738
LinkDB All DBs
Position
complement(1807370..1808716)
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTIDNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGVDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PAFALNFSRLGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPNNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVIDSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattgataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgacttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatccttgcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaaacctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcgtagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggtttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccagcatttgcactgaatttctcgcgacttggtggtcagatagtagcccagtattataat
tttgttaggttgggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaacaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattgattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcacattag

DBGET integrated database retrieval system