KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_0540Help
Entry
FTH_0540          CDS       T00399                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxymyristoyl-[acyl-carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00061  Fatty acid biosynthesis
fth00780  Biotin metabolism
fth01100  Metabolic pathways
fth01212  Fatty acid metabolism
Module
fth_M00083  Fatty acid biosynthesis, elongation
fth_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FTH_0540 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FTH_0540 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fth01004]
    FTH_0540 (fabZ)
Enzymes [BR:fth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FTH_0540 (fabZ)
Lipid biosynthesis proteins [BR:fth01004]
 Fatty acid synthase
  Component type
   FTH_0540 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ABI82513
UniProt: Q0BN21
LinkDB All DBs
Structure
PDB: 

Position
525455..525946
Genome map
AA seq 163 aa AA seqDB search
MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVAQKNVTINEDFFNGHFP
DFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtttaatcaaaataataaacagatagatgtaatggggattagaaaaatctta
cctcacaggtatccttttgcacttttggataagatcgttgattggagtgttgaagataga
acgattgttgcacaaaaaaatgtcactataaatgaagattttttcaatggacattttcct
gatttcccagttatgcctggtgtactgatagttgaagcgatggctcaagcaacggcaata
cttggtgaactaatggcagagacattgttcgcacatgttgttgagaaagctggtggtggt
agaagaacattcatgctagctggtattgataaggtaagggtcaaaagacctgtagtacca
ggagatgtgttagtaattgagtcgcgtatggtaaaacaaaaaaatattatctgtacagca
gagtcagtcgcaaaggttgatggacaaattgtttgttcagctgaattaatggcagcatat
aaggactactaa

DBGET integrated database retrieval system