KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1721Help
Entry
FTH_1721          CDS       T00399                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00020  Citrate cycle (TCA cycle)
fth00190  Oxidative phosphorylation
fth00650  Butanoate metabolism
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01120  Microbial metabolism in diverse environments
fth01130  Biosynthesis of antibiotics
fth01200  Carbon metabolism
Module
fth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fth_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTH_1721 (sdhB)
   00650 Butanoate metabolism
    FTH_1721 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FTH_1721 (sdhB)
Enzymes [BR:fth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FTH_1721 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     FTH_1721 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_4 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ABI83489
LinkDB All DBs
Position
complement(1717306..1718007)
Genome map
AA seq 233 aa AA seqDB search
MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQDPTLALRRSCREGVCG
SDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVNMKQFYKNYEKVKPYLIND
DEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS
RDTATQQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIGKIRSALLKKSV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaagatttaaaatttatagatataatccagaagttgataaaaaaccttattac
gatgagtatacagttgaagtagaaaatgaaggtgttaaggttctaacagctctagaatta
attaaagagcaggatcctaccttggctttaagaagatcttgtcgtgaaggtgtttgtggt
tctgatggtatgaatatcaacggcaagaatcgtttggcgtgtatcacttcggttggtgag
ttaaagcagcctattaaagttaatcctttaccagggttgccagttattagagatttaatc
gtcaatatgaaacagttctataagaattatgagaaagttaaaccatatcttatcaatgat
gatgagccgcctgttaaagagaggttacaatcaccagaggatagggctaaacttgatggg
ctgtatgagtgtattttatgtgcttgttgtactacatcgtgcccttcgttttggtggaat
cccgacaaatttataggtccttctggattgttacaagcttatagatttattgccgactca
agagatactgctacacagcaaagacttgaagatctaaaagatccatttagtcttttcaga
tgtaggactattatgaactgtgtttctgtgtgtccaaaaggtcttaaccctacagaagca
ataggtaagattagatcagcattattaaagaagagtgtataa

DBGET integrated database retrieval system