KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1722Help
Entry
FTH_1722          CDS       T00399                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00020  Citrate cycle (TCA cycle)
fth00190  Oxidative phosphorylation
fth00650  Butanoate metabolism
fth01100  Metabolic pathways
fth01110  Biosynthesis of secondary metabolites
fth01120  Microbial metabolism in diverse environments
fth01130  Biosynthesis of antibiotics
fth01200  Carbon metabolism
Module
fth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fth_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTH_1722 (sdhA)
   00650 Butanoate metabolism
    FTH_1722 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FTH_1722 (sdhA)
Enzymes [BR:fth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FTH_1722 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     FTH_1722 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABI83490
LinkDB All DBs
Position
complement(1718025..1719818)
Genome map
AA seq 597 aa AA seqDB search
MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRSHTVAAQGGIAAALGNI
EFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIELEHMGMPFSRLKNGKI
YQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGNLAHKTDFYTEWFAVDLVKAD
DGSIAGVIALCIETGETVFLKAKITILATGGAGRIYESSTNAYINTGDGMGLALRAGLPL
QDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDGERFMERYAPNAKDLACRDVVSRAS
QQEIMEGRGDTFSGTSCVWLDLTHLGEDVINERLPTVRELGRTFAGIDPVEKPIPVVPTC
HYQMGGIPTNKHGQVITQVDGKDKVIGGLYAVGECASVSVHGANRLGSNSLLDLVVFGRA
AGMHAEQSLKEGMPMKEVSQENIEKATARITKWDTSEQRGCKEKISELRKELQRVMQQYF
SVFRQESTMKEGLDKLFNIRERLDNAVLEDNSRIFNMMRIEALELDNLVLTAIATAKLAL
ERKESRGAHSRVDYPERDDKNWMKHTLYFLEGDRTSLRDVNMSSTKVKAFQPAERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctacgcaagaatttgatgctattgttatcggtgctggtggtgcgggttta
agagcttctttccagctgtcacagtcgggttttaaaactgctgttgtttctaaagtcttt
ccaacaagatcacatacggttgcagctcaaggtggtattgcagctgctttaggtaatatt
gaatttgatgatggcttgccatcagatgattggaagtggcatatgtatgatactgttaaa
ggttctgattatattggtgatcaggatgctattgagtatatgtgtgagcatgcgccacaa
tcaattattgagttggagcatatgggtatgcctttctcaagacttaaaaatggcaagata
tatcaacgagcgtttggtgggatgtcaaggaactatgatcctgctaatcaagcagaaaga
acttgcgcagcagctgataggaccgggcatgctcttttacatacgctgtatcagggtaac
ttagcgcacaaaactgatttctatacggagtggtttgctgttgatttggttaaggcggat
gatggtagtattgctggggttatagctctttgtatagaaactggtgaaactgttttctta
aaagcaaagattactatattagctactggtggcgctgggcgtatatacgagtcaagtact
aatgcttatatcaatactggtgatggtatgggtcttgctttaagagctggattacctctt
caagatatggagttttggcagttccatcctacaggcattgcaggtgctggagttcttgtt
actgaaggttgtcgcggtgaaggtggtgtgctacgcaataaagatggtgaaagatttatg
gagcgatatgctcctaatgctaaagatcttgcttgtcgtgatgttgtatcgcgtgcctct
cagcaagaaattatggaagggcgtggtgatactttctctgggacaagctgtgtgtggttg
gatttgactcacttgggtgaagacgtcattaatgagagattgcctactgttagagaatta
ggtagaacttttgctgggattgatccagttgaaaaaccaataccggttgtgcctacttgt
cattatcaaatgggtgggataccaactaataaacatggtcaagtaattactcaggtagat
ggtaaagataaggttataggtggattgtacgctgttggtgaatgcgcctctgtgtcagtt
catggtgcaaacaggcttggaagtaattctttattagatttagttgtttttggtagagct
gctggtatgcatgcggaacaaagcctaaaagaaggtatgcctatgaaagaagtttctcaa
gagaatattgagaaagctactgctagaatcactaagtgggatacttcagagcaaagaggc
tgtaaggaaaaaatttctgaattaagaaaagaattacagcgcgtaatgcagcagtacttc
tctgtatttaggcaagaaagcacaatgaaagaagggcttgataagttatttaatattaga
gaaaggttagataatgctgttctggaagataactctagaattttcaatatgatgagaata
gaagcgttagagttagataatctagtattaactgcgatagctactgcaaaattagcactt
gaaagaaaggaatcaagaggcgctcattcaagagtagactatcctgaaagagatgataag
aattggatgaagcatacgctatacttcttagaaggagatagaacatctctgcgtgatgta
aatatgtcttctactaaagtaaaagcttttcaaccagcagaacgtaagtactaa

DBGET integrated database retrieval system