KEGG   Francisella tularensis subsp. holarctica OSU18: FTH_1833Help
Entry
FTH_1833          CDS       T00399                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fth  Francisella tularensis subsp. holarctica OSU18
Pathway
fth00473  D-Alanine metabolism
fth00550  Peptidoglycan biosynthesis
fth01100  Metabolic pathways
fth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FTH_1833 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FTH_1833 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FTH_1833 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fth01011]
    FTH_1833 (ddlB)
Enzymes [BR:fth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FTH_1833 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:fth01011]
 Precursor biosynthesis
  Amino acid ligase
   FTH_1833 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 RimK ATP-grasp_4 ATP-grasp ATPgrasp_ST ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: ABI83583
UniProt: Q0BK01
LinkDB All DBs
Position
complement(1842771..1843661)
Genome map
AA seq 296 aa AA seqDB search
MKNEKIVVLYGGDSPEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKC
FVALHGEDGENGRVSALLEMLEIKHTSSSMKSSVITMDKMISKEILMHHRMPTPMAKFLT
DKLVAEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYEEASKYGEVMIEQWVTGKEIT
VAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHSPSGLCEQKELEVRQLAKKAYDLLGC
SGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaaaaattgttgttttatacggtggcgactctccagaaagagaagtttct
ttgaaatctggtaaagcagttttggattctttaataagccaaggttatgatgccgtaggt
gtggatgctagtggtaaagagctggtagcaaaacttttagaattaaagccagataagtgt
tttgttgcattacacggtgaagatggtgagaacggtagggtgtcagcattacttgagatg
ttagaaatcaagcatacaagctcatcgatgaaatcatctgtaattactatggataaaatg
atctctaaagaaatattgatgcatcatcggatgcctacaccgatggcaaaatttcttact
gataaattagttgcagaagatgagattagctttcctgttgcagttaagccaagtagtggt
ggttcaagtattgctacttttaaagtgaaatctatacaagagctcaaacatgcctatgaa
gaggcatcgaaatacggtgaggtaatgattgaacaatgggtcacaggtaaagaaattaca
gtggctattgtcaatgacgaggtttattcttctgtttggattgagccacaaaatgagttt
tatgattatgagtcaaagtatagtggtaaatcaatctatcattcaccgagtggtttatgc
gagcaaaaagaacttgaagttcgtcaattagctaaaaaagcttacgatctgcttggttgt
agcggtcatgcaagagtagactttatctatgatgataggggcaacttttacattatggag
ataaactcttcaccaggaatgaccgataatagtctatcgcctaagtcagcagcagcagag
ggggttgattttgatagttttgtgaagagaataatagaacaggcgcaatga

DBGET integrated database retrieval system