KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1395Help
Entry
FTL_1395          CDS       T00331                                 

Definition
(GenBank) Galactose-proton symporter, major facilitator superfamily (MFS) transport protein
  KO
K08137  MFS transporter, SP family, galactose:H+ symporter
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Brite
KEGG Orthology (KO) [BR:ftl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ftl02000]
    FTL_1395
Transporters [BR:ftl02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    FTL_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12
Motif
Other DBs
NCBI-ProteinID: CAJ79834
LinkDB All DBs
Position
complement(1325164..1326543)
Genome map
AA seq 459 aa AA seqDB search
MQTEKINFVVVRVAIIAALAGLLFGMDIGYVNGSLHFISETFGLSVEQSGHVSSVLLLGA
ACGALFSGFLSKRYGRRKVLLIAAAIFSIFTIVGMLAPNYQIFISSRFILGIAVGIASFI
APLYLSEIAPKEFRGALIALYQLMITIGLFLVFLTNSALERTGSWRVMLTVLAIPSVIMF
FGCLTLPRSPRWLILKGNDNEAALVLKKIRSSEAEALEEHNEIKQTTHRSVSVFSLLKQK
FFIKVVLLGIALQAFQQFTGMNAFMYYSTDIFKLAGFTNPSTSTIVIGLLNMLTTFLAIK
YVDKFGRKPILYFGLSLLIISCIIVGFIFKTHFVYGQAMVLSQTLQWTALIFCLLFIFGF
AISMGPVIWILCSEIQPIEGRDFGVTASTMSNWICNAIIGNFALTWLTFHPDSTFFGFAI
SCIICILFVKFFIPETKDVSLEEIENNLRSGKSLAKIGR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaaaaaataaattttgtggtcgttcgtgtggctataatagcagcacttgca
ggtctgctttttggtatggatattggttatgttaacggctcgttgcatttcatatcagaa
acatttggtttaagtgttgagcaaagtggacatgtatcaagtgtcttgctgcttggcgct
gcttgtggagcattatttagtggttttttatcaaagcgctatggacgtagaaaggtactt
ctaattgcagcagctattttttctatttttacaatagtgggaatgttggcacctaactac
caaatttttattagctcaagatttatcttgggtattgcggtaggtattgcttcatttatt
gcacctttgtatctatcagaaattgccccaaaagagtttagaggcgctttgattgctttg
taccagttaatgataactattggtttatttttggttttcttaactaactctgcattagaa
aggacaggttcttggagggttatgcttacagttttagcaattccttcagtaataatgttc
tttggctgcttgacattacctagaagtccaagatggcttattttaaaaggtaacgataat
gaggctgctttggttctcaaaaaaataagatcaagcgaagcagaagcattagaagagcat
aatgagattaaacaaacaacacatagaagtgttagtgttttttctttactcaagcagaag
ttttttataaaagttgtactactaggtatagctttgcaggcatttcaacagttcactggt
atgaatgcttttatgtattactcaacagatatctttaaattagcaggatttactaatcct
tcaacatcaacaatagtgatcggtttacttaatatgcttacaacctttttggcaattaag
tatgttgataaatttgggcgtaagccaattttatactttggcttaagcttattgataatc
tcatgtattattgttggttttatctttaaaacacactttgtttatggtcaagcaatggtc
ttatcacaaacattacaatggactgccttgatattttgtttattgttcatattcgggttt
gcaatttctatggggcctgtgatttggattttatgttcagaaatccaaccaattgagggt
agagattttggggtaacagcatcgactatgagtaattggatttgtaatgctattataggt
aattttgcacttacttggctaacatttcaccctgatagtactttctttggttttgcgatt
tcttgtataatttgtatattatttgttaagttttttatacctgaaactaaggatgtttca
ttagaggaaattgaaaacaatcttaggtcaggaaaatctttagcaaaaatcggtcgttaa

DBGET integrated database retrieval system