KEGG   Francisella tularensis subsp. holarctica LVS: FTL_1442Help
Entry
FTL_1442          CDS       T00331                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ftl  Francisella tularensis subsp. holarctica LVS
Pathway
ftl00061  Fatty acid biosynthesis
ftl00780  Biotin metabolism
ftl01100  Metabolic pathways
ftl01130  Biosynthesis of antibiotics
ftl01212  Fatty acid metabolism
Module
ftl_M00083  Fatty acid biosynthesis, elongation
ftl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ftl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FTL_1442
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FTL_1442
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FTL_1442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ftl01004]
    FTL_1442
Enzymes [BR:ftl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FTL_1442
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FTL_1442
Lipid biosynthesis proteins [BR:ftl01004]
 Fatty acid synthase
  Component type
   FTL_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: CAJ79881
LinkDB All DBs
Structure
PDB: 

Position
complement(1369371..1370153)
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVL
PCDVTSDKEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISA
YSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGED
GIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGI
TGEVVHVDAGYHCVSIGNVL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctagcaggaaaaaaaatattaatcactggacttttaagtaataagtcaatt
gcatatggtattgctaaagctatgcatagagagggagccgagcttgcttttacttatgtt
ggacagttcaaagatagagtggaaaaattatgtgcagaatttaatccagctgcagttttg
ccttgcgatgtgacttctgataaagagattaaggatttatttgtagagctaggtaaagtt
tgggatggtctagatgccatagttcattctatagcttttgcaccgcgtgatcagttagaa
ggtaactttattgactgtgtaactcgcgagggttttagtatcgctcatgatattagtgcc
tattcttttgcagcattagctaaagaaggtcgtagtatgatgaaaaatcgtaatgcttct
atggtagcacttacttatattggagcagaaaaagctatgccaagttacaatactatgggt
gttgctaaagcatctctagaagctacagttagatatacagcgttagctttaggtgaggat
ggtatcaaggtaaatgctgtatcagctggtcctatcaaaactctggcagcttctggtata
tcaaacttcaagaagatgcttgattataatgctatggtttctccacttaagaaaaatgtt
gatattatggaagttggtaatactgtagcgtttttatgttcagatatggcaactggtatc
actggagaagttgtccatgttgatgctggatatcattgtgtgtctataggtaatgttctt
taa

DBGET integrated database retrieval system