KEGG   Francisella tularensis subsp. mediasiatica FSC147: FTM_0340Help
Entry
FTM_0340          CDS       T00698                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ftm  Francisella tularensis subsp. mediasiatica FSC147
Pathway
ftm00330  Arginine and proline metabolism
ftm01100  Metabolic pathways
ftm01110  Biosynthesis of secondary metabolites
ftm01130  Biosynthesis of antibiotics
ftm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FTM_0340 (proC)
Enzymes [BR:ftm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     FTM_0340 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N PDH Sacchrp_dh_NADP YflT GFO_IDH_MocA ApbA
Motif
Other DBs
NCBI-ProteinID: ACD30391
LinkDB All DBs
Position
377000..377797
Genome map
AA seq 265 aa AA seqDB search
MKICFIGGGNMAAAMIAGMTSHGYKSQDIIVFDRNEHKCLNLIKKYNINTSTSLLNTIKL
ADILILAIKPQNMFELIKNIRDTVTSTQVIVTVAAGIQTSAYEELFNKEISFARTIPNTP
SSLGYGATGIFFNKVIAADKKDLVIDIMQTMGVVTVVEDEKEIDIIAAIASSGPAYYFQF
MEHMVEAAIKQGLDKKQAEKLVVQTCLGAAQMALNTNENMSELRKNVTSKKGITYEALNI
FEQFNLGGIVDKAIQASTAISYRIY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatgctttatcggtggtggtaatatggcggcagcaatgattgctggtatgacc
tcacatggttataaaagtcaggatataatcgtttttgatagaaatgaacataaatgctta
aacttaattaaaaagtataatatcaacacatctacgtcattactaaatacaattaaactt
gctgatattcttattttagcaatcaagcctcaaaatatgtttgagcttataaaaaatatc
agagatacagttacatctactcaagtaatagttacagtagctgcaggtatccagactagt
gcgtacgaggaattatttaacaaagaaatctcttttgctagaacaattccaaatacacct
agtagcttaggttacggcgctacgggaattttctttaataaagttattgctgctgataaa
aaagatttagttatagatattatgcagactatgggagtagtaactgttgttgaggatgag
aaagaaattgatattatcgcagctatagctagttctggaccggcatattattttcagttt
atggagcatatggttgaagcagcaatcaagcaaggtttagataaaaaacaagccgaaaaa
ctagttgttcaaacatgcttaggagcagcacagatggcattaaatactaatgaaaatatg
tcagagttaagaaaaaatgtaacttctaaaaaaggtataacttatgaagcattaaatatt
tttgagcaatttaatcttggtggaattgtagataaagcaattcaagcaagcacagcaatt
agctatagaatttactaa

DBGET integrated database retrieval system