KEGG   Francisella tularensis subsp. novicida U112: FTN_0917Help
Entry
FTN_0917          CDS       T00432                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ftn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FTN_0917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ftn01002]
    FTN_0917
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ftn01011]
    FTN_0917
Enzymes [BR:ftn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FTN_0917
   3.4.21  Serine endopeptidases
    3.4.21.-  
     FTN_0917
Peptidases [BR:ftn01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   FTN_0917
Peptidoglycan biosynthesis and degradation proteins [BR:ftn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   FTN_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABK89805
UniProt: A0Q6E0
LinkDB All DBs
Position
975232..976635
Genome map
AA seq 467 aa AA seqDB search
MKRKTKFFTALSILIISITTSQASTRSEVQYLVKKYNLSDAKIAIATQRTINGNQLYAYA
QNRAMKPASNNKVFTIVAALFAIPSDFRFTTSIMYPSDRVKDHTLYGDLYIKFTGNPALT
GSELATLIKKIKTEKGISKITGDVYLVGVFSGPYIPDGWSKEDSTFCYGAPASSFTLNRN
CTVIKLVKNTNSLTTRVVELSNASNITIKNTAKYTSASNATTIEMNDDNVLYIGGYLSRA
AEKMFKLAIRNPALKTLDTVNDFLNSDGIKHGNIVIASSVPAGYAEQITTRSQTIGHFID
QTLKHSDNLYAETILNTIGLKEKGIGSTKAGTEAVQSILYSKLGLDTSALTMYDGSGLSH
LDRVTPEFMVNFLTKAYNSQIGKEFYNYLPASGMSGTISYRMGGKLLGRVHAKTGTLSGV
STLSGYLLTAKNHRISFSIMLNDLKPSDRYNARRFQDKLVDVFYRNL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagaaaaactaagttttttacggcgttatctatattaattataagcataactact
tctcaagcatctacgcgtagtgaggttcagtatcttgtaaaaaagtataatctttctgat
gcaaagattgctatagcaactcaaagaacgatcaatggtaatcaattatatgcttatgcg
caaaacagagcaatgaaaccggcgagtaacaataaagtttttacaatagttgcagcactt
tttgctatacctagtgattttagatttacaacatcaataatgtacccttcagatagagta
aaagatcatactctgtatggagatttatatataaaatttactggtaatccggcactgact
ggtagtgaattagccacactgataaaaaaaataaaaactgagaaaggtatatctaaaata
actggcgatgtttaccttgttggagttttttctggaccatatatcccagatggctggtca
aaagaagatagtacattctgctatggtgccccagcatcaagcttcacactaaatagaaat
tgtacagttataaaattagttaaaaatactaatagcttaacaacaagagttgttgagttg
agtaacgcaagtaatatcactataaaaaatactgcaaagtacactagtgcctcaaatgca
actacaatagaaatgaatgatgataatgttttatacattggtggatacttatcaagagct
gctgaaaaaatgtttaaattagcgattagaaatcccgcacttaaaacattagataccgta
aatgacttcttaaattctgacggtattaaacatggtaatatcgttatagctagtagtgtt
cctgctggttatgctgaacagattacgacaagatctcaaacaatcggtcattttattgac
caaacccttaaacattctgataatctatatgccgagactatcttgaatactataggctta
aaagaaaaaggtattggctcaactaaagcaggtacagaagctgttcaaagtatactctac
tcaaaactaggcttagatacatcagctttaacaatgtatgatggttcgggtctatcacat
ttagatagagtaactccagaatttatggttaattttttaactaaagcttataatagtcag
attggcaaagagttctacaattacttaccagcatcaggtatgagtggtacaatttcatat
agaatgggtggtaaactacttggacgagtacatgctaaaactggtactctatccggagta
tcaacgttatcaggctatttattaacagctaaaaaccacagaatcagtttttcgattatg
cttaatgatcttaaaccctctgatcgttataatgcacgaagattccaagataaactagtt
gatgtcttctataggaatttataa

DBGET integrated database retrieval system