KEGG   Francisella tularensis subsp. novicida U112: FTN_1701Help
Entry
FTN_1701          CDS       T00432                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftn  Francisella tularensis subsp. novicida U112
Pathway
ftn00250  Alanine, aspartate and glutamate metabolism
ftn00410  beta-Alanine metabolism
ftn00430  Taurine and hypotaurine metabolism
ftn00650  Butanoate metabolism
ftn01100  Metabolic pathways
ftn01110  Biosynthesis of secondary metabolites
ftn01120  Microbial metabolism in diverse environments
ftn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FTN_1701
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTN_1701
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FTN_1701
   00430 Taurine and hypotaurine metabolism
    FTN_1701
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    FTN_1701
Enzymes [BR:ftn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FTN_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABK90558
UniProt: A0Q8J3
LinkDB All DBs
Position
complement(1822118..1823464)
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPTNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVINSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaaacccaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggtatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcattgaatttctcgcgacctggtggtcagatagtagcccagtattataat
tttgttaggttaggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaccaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttagca
cagttgatgattagagatttagttgcggtgattaattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system