KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00405Help
Entry
NE061598_00405    CDS       T01938                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00020  Citrate cycle (TCA cycle)
ftr00190  Oxidative phosphorylation
ftr00650  Butanoate metabolism
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01120  Microbial metabolism in diverse environments
ftr01130  Biosynthesis of antibiotics
ftr01200  Carbon metabolism
Module
ftr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE061598_00405
   00650 Butanoate metabolism
    NE061598_00405
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NE061598_00405
Enzymes [BR:ftr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NE061598_00405
    1.3.5.4  fumarate reductase (quinol)
     NE061598_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADA77753
LinkDB All DBs
Position
74741..76534
Genome map
AA seq 597 aa AA seqDB search
MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRSHTVAAQGGIAAALGNI
EFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIELEHMGMPFSRLKNGKI
YQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGNLAHKTDFYTEWFAVDLVKAD
DGSIAGVIALCIETGETVFLKAKITILATGGAGRIYESSTNAYINTGDGMGLALRAGLPL
QDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDGERFMERYAPNAKDLACRDVVSRAS
QQEIMEGRGDTFSGTSCVWLDLTHLGEDVINERLPTVRELGRTFAGIDPVEKPIPVVPTC
HYQMGGIPTNKHGQVITQVDGKDKVIGGLYAVGECASVSVHGANRLGSNSLLDLVVFGRA
AGMHAEQSLKEGMPMKEVSQENIEKATARITKWDTSEQRGCKEKISELRKELQRVMQQYF
SVFRQESTMKEGLDKLFNIRERLDNAVLEDNSRIFNMMRIEALELDNLVLTAIATAKLAL
ERKESRGAHSRVDYPERDDKNWMKHTLYFLEGDRTSLRDVNMSPTKVKAFQPAERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctacgcaagaatttgatgctattgttatcggtgctggtggtgcgggttta
agagcttctttccagctgtcacagtcgggttttaaaactgctgttgtttctaaagtcttt
ccaacaagatcacatacggttgcagctcaaggtggtattgcagctgctttaggtaatatt
gaatttgatgatggcttgccatcagatgattggaagtggcatatgtatgatactgttaaa
ggttctgattatattggtgatcaggatgctattgagtatatgtgtgagcatgcgccacaa
tcaattattgagttggagcatatgggtatgcctttctcaagacttaaaaatggcaagata
tatcaacgagcgtttggtgggatgtcaaggaactatgatcctgctaatcaagcagaaaga
acttgcgcagcagctgataggaccgggcatgctcttttacatacactgtatcagggtaac
ttagcgcacaaaactgatttctatacggagtggtttgctgttgatttggttaaggcggat
gatggtagtattgctggggttatagctctttgtatagaaactggtgaaactgttttctta
aaagcaaagattactatattagctactggtggcgctgggcgtatatacgagtcaagtact
aatgcttatatcaatactggtgatggtatgggtcttgctttaagagctggattacctctt
caagatatggagttttggcagttccatcctacaggcattgcaggtgctggagttcttgtt
actgaaggttgtcgcggtgaaggtggtgtgctacgcaataaagatggtgaaagatttatg
gagcgatatgctcctaatgctaaagatcttgcttgtcgtgatgttgtatcgcgtgcctct
cagcaagaaattatggaagggcgtggtgatactttctctgggacaagctgtgtgtggttg
gatttgactcacttgggtgaagacgtcattaatgagagattgcctactgttagagaatta
ggtagaacttttgctgggattgatccagttgaaaaaccaataccggttgtgcctacttgt
cattatcaaatgggtgggataccaactaataaacatggtcaagtaattactcaggttgat
ggtaaagataaggttataggtggattgtacgctgttggtgaatgcgcctctgtgtcagtt
catggtgcaaacaggcttggaagtaattctttattagatttagttgtttttggtagagct
gctggtatgcatgcggaacaaagcctaaaagaaggtatgcctatgaaagaagtttctcaa
gagaatattgagaaagctactgctagaatcactaagtgggatacttcagagcaaagaggc
tgtaaggaaaaaatttctgaattaagaaaagaattacagcgcgtaatgcagcagtacttc
tctgtatttaggcaagaaagcacaatgaaagaagggcttgataagttatttaatattaga
gaaaggttagataatgctgttctggaagataactctagaattttcaatatgatgagaata
gaagcgttagagttagataatctagtattaactgcgatagctactgcaaaattagcactt
gaaagaaaggaatcaagaggcgctcattcaagagtagactatcctgaaagagatgataag
aattggatgaagcatacgctatacttcttagaaggagatagaacatctctgcgtgatgta
aatatgtctcctactaaagtaaaagcttttcaaccagcagaacgtaagtactaa

DBGET integrated database retrieval system