KEGG   Francisella tularensis subsp. tularensis NE061598: NE061598_00410Help
Entry
NE061598_00410    CDS       T01938                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ftr  Francisella tularensis subsp. tularensis NE061598
Pathway
ftr00020  Citrate cycle (TCA cycle)
ftr00190  Oxidative phosphorylation
ftr00650  Butanoate metabolism
ftr01100  Metabolic pathways
ftr01110  Biosynthesis of secondary metabolites
ftr01120  Microbial metabolism in diverse environments
ftr01130  Biosynthesis of antibiotics
ftr01200  Carbon metabolism
Module
ftr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ftr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ftr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE061598_00410 (sdhB)
   00650 Butanoate metabolism
    NE061598_00410 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NE061598_00410 (sdhB)
Enzymes [BR:ftr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NE061598_00410 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NE061598_00410 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_4 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ADA77754
LinkDB All DBs
Position
76552..77253
Genome map
AA seq 233 aa AA seqDB search
MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQDPTLALRRSCREGVCG
SDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVDMKQFYKNYEKVKPYLIND
DEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS
RDTATEQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIGKIRSALLKKNV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaagatttaaaatttatagatataatccagaagttgataaaaaaccttattac
gatgagtatacggttgaagtagaaaatgaaggtgttaaggttctaacagctctagaatta
attaaagagcaggatcctaccttggctttaagaagatcttgtcgtgaaggtgtttgtggt
tctgatggtatgaatatcaacggcaagaatcgtttggcgtgtatcacttcggttggtgag
ttaaagcagcctattaaagttaatcctttaccagggttgccagttattagagatttaatc
gtcgatatgaaacagttctataagaattatgagaaagttaaaccatatcttatcaatgat
gatgagccgcctgttaaagagaggttacaatcaccagaggatagggctaaacttgatggg
ctgtatgagtgtattttatgtgcttgttgtactacatcgtgcccttcgttttggtggaat
cccgacaaatttataggtccttctggattgttacaagcttatagatttatcgccgactca
agagatactgctacagagcaaagacttgaagatctaaaagatccatttagtcttttcaga
tgtaggactattatgaactgtgtttctgtgtgtccaaaaggtcttaaccctacagaagca
ataggtaagattagatcagcattattaaagaagaatgtataa

DBGET integrated database retrieval system