KEGG   Francisella tularensis subsp. holarctica F92: F92_05860Help
Entry
F92_05860         CDS       T02349                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00550  Peptidoglycan biosynthesis
fts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fts00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F92_05860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fts01002]
    F92_05860
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fts01011]
    F92_05860
Enzymes [BR:fts01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     F92_05860
Peptidases and inhibitors [BR:fts01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   F92_05860
Peptidoglycan biosynthesis and degradation proteins [BR:fts01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   F92_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AFX70719
LinkDB All DBs
Structure
PDB: 

Position
complement(1011422..1012756)
Genome map
AA seq 444 aa AA seqDB search
MKLTKIALLIASITAGVAFAAPNISAGSDPYFNGANGLAQKNIIIRPANIELDAPAWVTM
DYRTGDIVSEKNMDVRRAPASLTKIMTSYIVASEIKAGNLSWDTMIPISENAASTGGSKM
YVKAGAKVSVRNLVTGMDVVSGNDATIALAEYIGGTTQAFTDLMNQTAKAIGMNNTHFAN
PDGLPGGEQYTTAHDMALLARSYIYNFPEAYKVYDDKGLVWNATKQDSVSIADRKQCLPK
FDRATGNVIESYTVKDLDDQAKDKCNKLFPKGDNFVLQNNRNRLLFTFDGADGMKTGHTD
AAGYCLVSSVKQDGERFISVVLGTTSSAKRDSESAKLLRYALSKYENVLLYKANSPVTIS
ADNIPNAKAGQKLTVASNQNIYKTVPKTYVPYLKQGIEFNPNLNAPIKTGQNVGNLVITL
GDTKEEIASIPVVAMNNVSQKGWW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacaaaaatagctttattaatagctagtataacagcgggggtagcttttgct
gcgcctaatatatctgccggctctgatccttatttcaatggagctaatggactcgcgcag
aaaaatattattataagacctgcaaacattgagctagatgctccagcttgggtaacgatg
gattatcgtactggagatattgttagtgaaaaaaatatggacgtcagaagagcccctgca
agcttaactaaaatcatgacttcctatatagttgctagtgaaataaaagctggtaatcta
agctgggatacaatgatcccaattagtgagaatgctgcttctacaggtggttcaaagatg
tatgttaaagccggtgctaaggtatctgtaagaaatcttgtaactggtatggatgtagtg
tctggtaatgatgctactattgctcttgctgaatatatcggcggaactacacaagccttt
actgatttaatgaatcaaacagcaaaggctattggcatgaataatactcattttgctaat
ccagatggacttccaggtggtgagcaatatactactgctcatgatatggcgttgcttgca
agatcatacatatataatttcccagaagcatataaagtatacgacgataagggcttagtt
tggaatgccacaaaacaagactcggtaagtattgctgatcgtaaacagtgcttacctaag
tttgatcgcgctactggaaatgtcatagagagctatacggtcaaagatcttgatgatcaa
gctaaagataaatgtaataagctttttcctaaaggtgataatttcgtattacaaaataat
agaaatagattactatttacatttgatggggctgatggtatgaagactggtcatactgat
gctgctggatactgtctagtttcatctgttaaacaagatggcgagagatttatttctgta
gttcttggtactactagttctgctaagagagattcagaatcagctaaattactaagatat
gctctgagtaagtatgaaaatgtacttttatacaaagcaaattctccagttacaattagt
gctgataatatccctaatgcaaaagctggacaaaagttaactgtagcttcaaatcaaaat
atttataaaacagtacctaaaacttatgtcccttatctaaagcaaggtatagaatttaat
ccaaatttgaacgctcctattaaaacaggtcaaaatgtaggtaatttagtgattacacta
ggtgatactaaggaggaaattgctagtatacctgtagttgctatgaataatgtttcacaa
aaaggttggtggtaa

DBGET integrated database retrieval system