KEGG   Francisella tularensis subsp. holarctica F92: F92_09895Help
Entry
F92_09895         CDS       T02349                                 

Definition
(GenBank) succinate dehydrogenase, catalytic and NAD/flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
fts  Francisella tularensis subsp. holarctica F92
Pathway
fts00020  Citrate cycle (TCA cycle)
fts00190  Oxidative phosphorylation
fts00650  Butanoate metabolism
fts01100  Metabolic pathways
fts01110  Biosynthesis of secondary metabolites
fts01120  Microbial metabolism in diverse environments
fts01130  Biosynthesis of antibiotics
fts01200  Carbon metabolism
Module
fts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fts_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F92_09895
   00650 Butanoate metabolism
    F92_09895
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    F92_09895
Enzymes [BR:fts01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     F92_09895
    1.3.5.4  fumarate reductase (quinol)
     F92_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFX71400
LinkDB All DBs
Position
complement(1710294..1712087)
Genome map
AA seq 597 aa AA seqDB search
MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRSHTVAAQGGIAAALGNI
EFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIELEHMGMPFSRLKNGKI
YQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGNLAHKTDFYTEWFAVDLVKAD
DGSIAGVIALCIETGETVFLKAKITILATGGAGRIYESSTNAYINTGDGMGLALRAGLPL
QDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDGERFMERYAPNAKDLACRDVVSRAS
QQEIMEGRGDTFSGTSCVWLDLTHLGEDVINERLPTVRELGRTFAGIDPVEKPIPVVPTC
HYQMGGIPTNKHGQVITQVDGKDKVIGGLYAVGECASVSVHGANRLGSNSLLDLVVFGRA
AGMHAEQSLKEGMPMKEVSQENIEKAIARITKWDTSEQRGCKEKISELRKELQRVMQQYF
SVFRQESTMKEGLDKLFNIRERLDNAVLEDNSRIFNMMRIEALELDNLVLTAIATAKLAL
ERKESRGAHSRVDYPERDDKNWMKHTLYFLEGDRTSLRDVNMSSTKVKAFQPAERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctacgcaagaatttgatgctattgttatcggtgctggtggtgcgggttta
agagcttctttccagctgtcacagtcgggttttaaaactgctgttgtttctaaagtcttt
ccaacaagatcacatacggttgcagctcaaggtggtattgcagctgctttaggtaatatt
gaatttgatgatggcttgccatcagatgattggaagtggcatatgtatgatactgttaaa
ggttctgattatattggtgatcaggatgctattgagtatatgtgtgagcatgcgccacaa
tcaattattgagttggagcatatgggtatgcctttctcaagacttaaaaatggcaagata
tatcaacgagcgtttggtgggatgtcaaggaactatgatcctgctaatcaagcagaaaga
acttgcgcagcagctgataggaccgggcatgctcttttacatacgctgtatcagggtaac
ttagcgcacaaaactgatttctatacggagtggtttgctgttgatttggttaaggcggat
gatggtagtattgctggggttatagctctttgtatagaaactggtgaaactgttttctta
aaagcaaagattactatattagctactggtggcgctgggcgtatatacgagtcaagtact
aatgcttatatcaatactggtgatggtatgggtcttgctttaagagctggattacctctt
caagatatggagttttggcagttccatcctacaggcattgcaggtgctggagttcttgtt
actgaaggttgtcgcggtgaaggtggtgtgctacgcaataaagatggtgaaagatttatg
gagcgatatgctcctaatgctaaagatcttgcttgtcgtgatgttgtatcgcgtgcctct
cagcaagaaattatggaagggcgtggtgatactttctctgggacaagctgtgtgtggttg
gatttgactcacttgggtgaagacgtcattaatgagagattgcctactgttagagaatta
ggtagaacttttgctgggattgatccagttgaaaaaccaataccggttgtgcctacttgt
cattatcaaatgggtgggataccaactaataaacatggtcaagtaattactcaggtagat
ggtaaagataaggttataggtggattgtacgctgttggtgaatgcgcctctgtgtcagtt
catggtgcaaacaggcttggaagtaattctttattagatttagttgtttttggtagagct
gctggtatgcatgcggaacaaagcctaaaagaaggtatgcctatgaaagaagtttctcaa
gagaatattgagaaagctattgctagaatcactaagtgggatacttcagagcaaagaggc
tgtaaggaaaaaatttctgaattaagaaaagaattacagcgcgtaatgcagcagtacttc
tctgtatttaggcaagaaagcacaatgaaagaagggcttgataagttatttaatattaga
gaaaggttagataatgctgttctggaagataactctagaattttcaatatgatgagaata
gaagcgttagagttagataatctagtattaactgcgatagctactgcaaaattagcactt
gaaagaaaggaatcaagaggcgctcattcaagagtagactatcctgaaagagatgataag
aattggatgaagcatacgctatacttcttagaaggagatagaacatctctgcgtgatgta
aatatgtcttctactaaagtaaaagcttttcaaccagcagaacgtaagtactaa

DBGET integrated database retrieval system