KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_1104Help
Entry
FTV_1104          CDS       T01761                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftt01100  Metabolic pathways
ftt01110  Biosynthesis of secondary metabolites
ftt01130  Biosynthesis of antibiotics
ftt01230  Biosynthesis of amino acids
Module
ftt_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ftt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTV_1104 (aroK)
Enzymes [BR:ftt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     FTV_1104 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin AAA_22 AAA_17 CoaE dNK AAA AAA_16 ABC_tran AAA_PrkA TsaE APS_kinase AAA_24 AAA_7 Guanylate_kin Ploopntkinase3 ATPase_2 AAA_5 RNA_helicase Rad17 AAA_29 AAA_14 PduV-EutP RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFB80764
LinkDB All DBs
Position
complement(1168131..1168661)
Genome map
AA seq 176 aa AA seqDB search
MIRTKNIFLIGPVGAGKSTIGKQLAKQLKLEFIDSDDVIEKKCGVDINWIFDLEGEEGFR
KREREVIAEILAEKQNIVLATGGGAILDPETRSLLSSRGKVVYLEATIEQQLERTSKDTK
RPLLRVDDKRPVLEQLMAEREPLYRSIADVVVETNGATVKNIVNKISTFLVEETIL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgataagaacaaaaaatattttcttaattggtccagttggtgctggaaaatctactatt
ggtaagcagttagcaaaacagttaaagttagaatttatcgattctgatgatgttattgaa
aaaaaatgcggcgttgatattaactggatctttgatctagaaggtgaagaaggttttaga
aagcgtgaaagagaagtaattgctgagattttagctgaaaaacaaaatatagttttagct
accggtggtggtgctatacttgatccagaaactagatcactactgtcatcacgaggtaag
gttgtctaccttgaggcaacaattgagcaacagcttgagagaacttctaaagatactaaa
agaccattattaagagttgatgataaaagaccagttcttgagcagttaatggctgaaaga
gagccattatatagaagtatcgctgatgtggttgtggaaactaatggtgcaacagttaaa
aatattgtgaataaaatatcgacatttttagtagaagaaactatcctgtga

DBGET integrated database retrieval system