KEGG   Francisella tularensis subsp. holarctica VT68: CH67_1133Help
Entry
CH67_1133         CDS       T03714                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase 1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ftv  Francisella tularensis subsp. holarctica VT68
Pathway
ftv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftv01100  Metabolic pathways
ftv01110  Biosynthesis of secondary metabolites
ftv01130  Biosynthesis of antibiotics
ftv01230  Biosynthesis of amino acids
Module
ftv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ftv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CH67_1133 (aroK)
Enzymes [BR:ftv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CH67_1133 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin AAA_22 AAA_17 CoaE dNK AAA AAA_16 ABC_tran AAA_PrkA TsaE APS_kinase AAA_7 AAA_24 Guanylate_kin Ploopntkinase3 AAA_5 ATPase_2 RNA_helicase Rad17 AAA_29 AAA_14 PduV-EutP RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJI64852
UniProt: A0A0B3VYD0
LinkDB All DBs
Position
1013398..1013928
Genome map
AA seq 176 aa AA seqDB search
MIRTKNIFLIGPVGAGKSTIGKQLAKQLKLEFIDSDDVIEKKCGVDINWIFDLEGEEGFR
KREREVISEILAEKQNIVLATGGGAILDPETRSLLSSRGKVVYLEATIEQQLERTSKDTK
RPLLRVDDKRPVLEQLMAEREPLYRSIADVVVETNGATVKNIVNKISTFLVEETIL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgataagaacaaaaaatattttcttaattggtccagttggtgctggaaaatctactatt
ggtaagcagttagcaaaacagttaaagttagaatttatcgattctgatgatgttattgaa
aaaaaatgcggcgttgatattaactggatctttgatctagaaggtgaagaaggttttaga
aagcgtgaaagagaagtaatttctgagattttagctgaaaaacaaaatatagttttagct
accggtggtggtgctatacttgatccagaaactagatcactactgtcatcacgaggtaag
gttgtctaccttgaggcaacaattgagcaacagcttgagagaacttctaaagatactaaa
agaccattattaagagttgatgataaaagaccagttcttgagcagttaatggctgaaaga
gagccattatatagaagtatcgctgatgtggttgtggaaactaatggtgcaacagttaaa
aatattgtgaataaaatatcgacatttttagtagaagaaactatcctgtga

DBGET integrated database retrieval system