KEGG   Francisella tularensis subsp. holarctica VT68: CH67_1492Help
Entry
CH67_1492         CDS       T03714                                 

Gene name
fabF
Definition
(GenBank) beta-ketoacyl-acyl-carrier-protein synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ftv  Francisella tularensis subsp. holarctica VT68
Pathway
ftv00061  Fatty acid biosynthesis
ftv00780  Biotin metabolism
ftv01100  Metabolic pathways
ftv01212  Fatty acid metabolism
Module
ftv_M00083  Fatty acid biosynthesis, elongation
ftv_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ftv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH67_1492 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH67_1492 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ftv01004]
    CH67_1492 (fabF)
Enzymes [BR:ftv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     CH67_1492 (fabF)
Lipid biosynthesis proteins [BR:ftv01004]
 Fatty acid synthase
  Component type
   CH67_1492 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C ACP_syn_III Thiolase_N KAsynt_C_assoc SpoVAD
Motif
Other DBs
NCBI-ProteinID: AJI66106
UniProt: A0A0B3WI34
LinkDB All DBs
Position
complement(1306970..1308229)
Genome map
AA seq 419 aa AA seqDB search
MKSNRRVVVTGLGMVTPLGNDVPTTWANILAGKSGVETITGFDTPAPDISEFKVRFAARI
KNFDVDALVGKKDAKRVDPFCYYGIAAANEALKDAGIDKVSEEDSYKFGVCVSSGIGGIE
TLETTKAVIDTKGPSKISPFCIPSSIVNMLSGIISINHGLRGPNIPIVTACTTGTHNIGM
AARLIASGDADAMLAGGSEKASNAIGMGGFAAARALSTRNDDPQGASRPWDKDRDGFVLG
DGAGVVVLEEYERAKARGAKIYAEVVGFGMSADGYHMTMPYAPGQERCIQNALADAGLEN
NPDAIDYVNAHGTSTPLGDVQESQVVEKVIGQYRKDLVMSSTKSMTGHLLGAAGAIESIF
SVLAIRDQVAPPTINLHNLDDGCNLDYAANAAKKMKIDYVLNNSFGFGGTNGSVIFKKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaatcgtagagtagttgttactggcttaggcatggtaacacctttaggaaat
gatgtccctacgacttgggctaatatcttagctggcaaaagtggagtagaaactataact
ggttttgacacacctgctcctgatattagcgagtttaaagttagatttgcagcaagaatt
aaaaattttgatgtagatgcacttgtaggtaaaaaagacgcaaagagagtagatcctttc
tgctactatggtattgccgctgctaatgaagctcttaaagatgctggaattgataaagta
tctgaagaagattcatataagtttggcgtatgtgttagttctggtatcggtggtatcgag
actttagaaactactaaagctgtaatagatacaaaaggaccttctaaaatttcacctttt
tgtataccatcctcaatcgtgaatatgctctctggaatcatttctataaatcatggctta
cgtgggcctaatattccaatcgttactgcttgtactacaggtactcataatattggtatg
gctgctagattaatagctagtggtgatgctgatgctatgcttgctggtggctctgaaaaa
gcaagtaacgctattggtatgggtggatttgctgctgctagagcattatcaacgcgcaat
gatgatccacaaggtgcatcacgcccttgggacaaagacagagatggctttgtacttggc
gatggtgctggtgttgttgtcttagaagaatatgaaagagctaaagctcgtggcgctaag
atttatgctgaggttgtgggttttggtatgtctgctgatggttatcatatgactatgcct
tatgctccaggtcaagaaagatgtattcagaatgctttagctgatgctggacttgaaaat
aatcctgatgctatagactacgttaatgctcacggtacttcaactccactaggagatgtt
caggagtcacaagttgttgaaaaagtaattggacaatatagaaaagatctagttatgagc
tcaacaaaatcaatgacaggacatttacttggtgcagctggtgctattgaatcaatattt
agtgtattagcaataagagaccaagtagctccaccaacaataaacctacataatttagat
gatggctgtaacttagattatgctgcaaatgctgctaagaaaatgaaaattgattatgtg
ctaaataactcttttggttttggtggcactaatggttctgtaattttcaaaaaaatctaa

DBGET integrated database retrieval system