KEGG   Francisella tularensis subsp. holarctica VT68: CH67_860Help
Entry
CH67_860          CDS       T03714                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ftv  Francisella tularensis subsp. holarctica VT68
Pathway
ftv00330  Arginine and proline metabolism
ftv01100  Metabolic pathways
ftv01110  Biosynthesis of secondary metabolites
ftv01130  Biosynthesis of antibiotics
ftv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CH67_860 (proC)
Enzymes [BR:ftv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CH67_860 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N PDH Sacchrp_dh_NADP YflT GFO_IDH_MocA ApbA
Motif
Other DBs
NCBI-ProteinID: AJI65062
UniProt: A0A0B3VNX2
LinkDB All DBs
Position
758831..759655
Genome map
AA seq 274 aa AA seqDB search
MKICFIGGGNMAAAMIAGMTSHGYKSQDIIVFDRNEHKCLNLIKKYNINTSTSLLNTIKL
ADILILAIKPQNMFELIKNIRDTVTSTQVIVTVAAGIQTSAYEELFNKEISFARTIPNTP
SSLGYGATGIFFNKVIAADKKDLVIDIMQTIGVVTVVEDEKEIDIIAAIASSGPAYYFQF
MEHMVEAAIKQGLDKKQAEKLVVQTCLGAAQMALNTNENMSELRKNVTSKKGITYEALNI
FEQFNLGGIVDKAIQANIARAQQLAIEFTKLIDN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatgctttatcggtggtggtaatatggcggcagcaatgattgctggtatgacc
tcacatggttataaaagtcaggatataatcgtttttgatagaaatgaacataaatgctta
aacttaattaaaaagtataatatcaacacatctacgtcattactaaatacaattaaactt
gctgatattcttattttagcaatcaagcctcaaaatatgtttgagcttataaaaaatatc
agagatacagttacatctactcaagtaatagttacagtagctgcaggtatccagactagt
gcgtacgaggaattatttaacaaagaaatctcttttgctagaacaattccaaatacacct
agtagcttaggttacggcgctacgggaattttctttaataaagttattgctgctgataaa
aaagatttagttatagatattatgcagactataggagtagtaactgttgttgaggatgag
aaagaaattgatattatcgcagctatagctagttctggaccggcatattattttcagttt
atggagcatatggttgaagcagcaatcaagcaaggtttagataaaaaacaagccgaaaaa
ctagttgttcaaacatgcttaggagcagcacagatggcattaaatactaatgaaaatatg
tcagagttaagaaaaaatgtaacttctaaaaaaggtataacttatgaagcattaaatatt
tttgagcaatttaatcttggtggaattgtagataaagcaattcaagcaaatatagctaga
gcacagcaattagctatagaatttactaaattaatagataattga

DBGET integrated database retrieval system