KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0223Help
Entry
FTW_0223          CDS       T00495                                 

Definition
(GenBank) Major Intrinsic Protein (MIP) family permease
  KO
K02440  glycerol uptake facilitator protein
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ftw02000]
    FTW_0223
Transporters [BR:ftw02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    FTW_0223
Ion channels [BR:ftw04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   FTW_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: ABO46190
LinkDB All DBs
Position
230660..231424
Genome map
AA seq 254 aa AA seqDB search
MLTACIAELIGTMLLILLGNGVVAGVVLNKTKAHDGGWIVITFAWGLAVFIGVLVAGPIS
GAHLNPVVTLSLALAGKFSWAWVLPFIISQIIGAMLGQLLVWIMYYPHYSATDNPELKLA
TCCTSPAIKHLPANFASEVIGTFVLVLAILTMHGVVLHVGDSSITTTYPVDMGALGGIPV
AFVVVVIGMSLGGTTGYAINPARDFGPRLFHAIMPIQGKGSSQWSYAWVPILGPVCGSII
ATAFYLLLKVKGVF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagcatgtatagcagaattaataggcacaatgctacttatcttattgggtaat
ggtgttgttgctggagtagttttaaataagacaaaagcacatgatggtggctggatagtt
attacatttgcttggggtctagctgtttttataggtgtgttagttgctggaccgattagt
ggtgctcacttgaatcctgttgtaacattatctttagctcttgcgggtaagttttcatgg
gcttgggtattaccatttattataagtcagattatcggagcgatgcttggtcaactatta
gtgtggattatgtattatcctcattattcagcaactgataatcctgaactaaaattagcg
acttgttgcacatcaccagcaattaagcatttgccagcgaattttgctagtgaagtaatt
ggaacatttgttctagtactagctattttgactatgcatggtgttgtcttacatgtcgga
gactctagtataacaacaacttatccagtagatatgggcgctctagggggtataccagta
gcatttgtggttgttgtaatcggcatgtccttaggtgggactacaggttatgcaattaat
ccagctagagattttggcccaagactatttcatgctatcatgccaatacaaggaaaaggc
tcttcacaatggagttatgcttgggtaccgatacttggtccagtgtgtggaagtataatt
gccacagctttttatctattgttaaaggtaaaaggggttttttag

DBGET integrated database retrieval system