KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1555Help
Entry
FTW_1555          CDS       T00495                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase, B subunit
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ftw03032]
    FTW_1555 (gyrB)
   03400 DNA repair and recombination proteins [BR:ftw03400]
    FTW_1555 (gyrB)
Enzymes [BR:ftw01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     FTW_1555 (gyrB)
DNA replication proteins [BR:ftw03032]
 Prokaryotic type
  DNA Topoisomerases
   FTW_1555 (gyrB)
DNA repair and recombination proteins [BR:ftw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      FTW_1555 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C GyrB_insert HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABO47266
LinkDB All DBs
Position
complement(1459703..1462114)
Genome map
AA seq 803 aa AA seqDB search
MSENKAYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVVDNAIDEALAGYCDD
IKVIINKDGSVSVSDNGRGIPTDIHKEEGRSAAEVILTVLHAGGKFDDNSYKVSGGLHGV
GVSVVNALSEQLKLTIYRNGIEHYQEYVHGVPQFPLKEVGSTDKTGTLITFKPSKETFSF
VDFDYDILMKRIRELSFLNSGVKIELIDKINNRSEIFKYDGGIVAFVKYLNNSKKPIHEN
VIAVNGIKDDIQVELALQWNDSYKESIFCFTNNIPQRDGGTHLSGLKAAVTRTMNNYIES
EGLNKKLKVTLTGEDTREGLAAVLSVKVPDPKFSSQTKDKLVSSDVKSAVESLVNEKLQE
FLLENPKEAKIICEKILDSAKAREAARKARDMTRRKGALDIAGLPGKLADCQEKDPALSE
IYLVEGDSAGGSAKQARDRKTQAILPLKGKILNVEKARFDKMLGSQEVATLIKALGCGIG
AEDYNPDKTRYHKIILMTDADVDGSHIRTLLLTFFYRQMPELVERGYLYIAQPPLYKVKK
GKQETYLKDEDALAEYLGNIGLEGACIYLSNGNVISGQVLANYYELYQKSQKVIKKYTKT
YPEKLLRVMAYGTKYVDESADISEWWQKIVENCNQKALAYERFKLIETKDIGEDGKENIS
YGVNHYINGYDTDYIVKSSFFSTKDYEDLVTYGDVLSDISFEGAYVERGAKKEYVDDFES
AIDWLLKEARKGNDVQRYKGLGEMNPGQLWETTMDPDNRVLLQVSIKDAVEADALFTTLM
GDEVEPRRNFIESNALNVVNLDV
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataaagcttatgactcatcgagtattaaggtacttaaaggtttagatgct
gttagaaaaagacctgggatgtatattggtgataccgatgatggtagcggcttacatcat
atggtatttgaggttgttgataatgctatcgatgaagccttagctggttattgtgatgat
attaaagttattataaataaggatggctctgtatctgtatcagataatggtagaggtatt
cctacagatattcataaagaagaagggcgctctgcagcagaggttattttgacagtattg
catgcaggtggtaagtttgatgataactcttataaagtatcaggcggtttacatggtgtt
ggtgtatcagttgtaaatgcgctttcagaacaattaaagttaacaatttatagaaatggt
atcgagcactatcaagagtatgttcatggagtaccacagtttccattaaaagaagttggt
tcaacagataagaccggaacactaattacttttaaaccgagtaaagaaacgttttcattt
gttgacttcgattatgatatcttgatgaagagaattcgagagttatctttcttaaactct
ggcgtcaaaattgaacttattgataaaattaataataggtcagaaatatttaagtatgat
ggtggtatagttgcttttgttaagtatttgaacaatagcaaaaaacctattcatgaaaat
gttatagctgtaaatggtatcaaagatgatattcaagtagagcttgctttgcaatggaat
gactcatataaagaatcaattttttgctttacaaataatatcccacaaagagatggtggt
acgcatttatctggccttaaagcagctgttactcgtacgatgaataattatattgaatca
gaaggtttaaataaaaagctaaaagttactttaacaggtgaagatacgcgcgaaggttta
gctgcagttttatctgtgaaagttcctgatccaaaattctcatcacaaactaaagataaa
ctagtatcatctgatgttaaatcagctgtagagtcattagttaatgaaaaactacaagag
tttcttttagaaaaccctaaagaagctaaaattatatgtgagaaaattttagattcagca
aaagctcgtgaagctgctcgtaaagcccgtgatatgacgcgtcgtaagggtgctttggat
attgctggcctacctggtaagttagcagattgccaagaaaaagatccggcattgtctgaa
atttatcttgttgagggagactctgcaggaggttcagcaaagcaggctcgtgatcgtaaa
acgcaggcgattttgccactaaaaggtaagattctcaatgttgagaaagcacgttttgat
aaaatgcttggttctcaagaggtagctacgctcattaaagctctaggttgtggtataggt
gcggaagattataaccctgataaaactagatatcacaaaattatcctaatgacggatgct
gatgttgatggctcgcatattagaacacttcttttgacatttttctatagacaaatgcca
gagcttgttgagagagggtatttatatattgctcaaccacctttatataaggtaaaaaaa
ggtaagcaagaaacatatctaaaagatgaagatgctttggcagaatatcttggtaatata
ggtctagaaggcgcgtgtatctatttaagtaatggcaatgttatttctggtcaagttttg
gctaattattatgagctttatcagaagtcacaaaaagtaattaaaaaatatacaaaaacg
tatcctgagaagcttcttagagttatggcatatggaactaagtatgttgatgaaagtgcg
gatatctctgagtggtggcagaaaattgttgaaaattgtaatcaaaaggctttagcatat
gagcgctttaagcttatagaaacaaaagatataggtgaggatggtaaagagaatatatca
tatggagttaatcattatattaatggttatgatactgactatattgttaagagtagtttc
tttagtactaaagattatgaagatctagttacatatggagatgttttatcggatatatct
tttgaaggagcttatgtagagagaggtgctaaaaaagaatatgttgatgattttgaatca
gcaattgattggttgcttaaagaagctagaaaaggtaatgatgtacagcgttataaaggt
ctaggtgagatgaatcctggtcagctttgggaaactactatggatcctgataatagagtt
cttctacaagtatcaataaaagatgcggttgaagctgatgctttatttactactctgatg
ggtgatgaggttgagccacgcagaaactttattgagtcaaatgctcttaatgtggttaac
ttagacgtttaa

DBGET integrated database retrieval system