KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1690Help
Entry
FTW_1690          CDS       T00495                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00564  Glycerophospholipid metabolism
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
Module
ftw_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FTW_1690 (psd)
Enzymes [BR:ftw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FTW_1690 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ABO47380
UniProt: A4IZN0
LinkDB All DBs
Position
1605743..1606594
Genome map
AA seq 283 aa AA seqDB search
MRDNLFIYLQYLLPHTLTSRLVSKLADSENKIIKNHLIKLAIKKFNINLVEAKETDISKY
KSFNDFFIRELKDDLRPISNDKNVISSPADGVLSQFGTITDNSLIQAKGKLFSLESLIAS
SSTTSFTKFATIYLSPKDYHRVHMPIDGKLTKMVYIPGKLFSVNKITTSKVDNLFAKNER
LICYFDTIIGEIAVIFVGALLVAGIETVWHGKIAPNYYKDIQTWDYNSAKFNIKFNKGDI
LGWFNFGSTVIILTSGNNVSFKFEENKNNIKIQVNQDLALITE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagagataatttatttatatatttacaatatctacttcctcacactttaacatcacgt
ttagttagtaaacttgctgactcagaaaataaaattattaaaaaccatctaataaaactt
gctattaagaaattcaatattaatttagttgaagctaaagaaaccgatataagcaaatac
aaatcttttaatgattttttcataagagaacttaaagatgatttaagacccatttctaat
gataaaaatgttatctcctctcctgcagatggtgtattaagtcaattcggcacgataact
gataatagtctaattcaagccaaaggtaaactcttttctctagaatcattaattgctagt
agttcaacaactagcttcacaaaatttgcaactatatatctttcaccaaaagattatcat
agagtacatatgcctatagatggaaagcttacaaagatggtttatattccaggcaaactt
ttctcggttaataaaataacgaccagtaaagttgataatctctttgcaaaaaatgaacgt
ctaatctgctactttgatacaataattggagaaattgcagtaatttttgtcggtgctctt
ttagttgcaggtatagaaacagtatggcatggtaaaattgctccgaactactacaaagac
atacaaacttgggactataattctgctaaatttaatatcaaattcaataaaggcgatata
cttggatggtttaacttcggctcaacagtaattattttaacttctggaaataatgtcagt
ttcaaatttgaagagaataaaaataatattaaaatacaagtaaatcaagatttagctttg
attacagaataa

DBGET integrated database retrieval system