KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_2025Help
Entry
FTW_2025          CDS       T00495                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01130  Biosynthesis of antibiotics
ftw01230  Biosynthesis of amino acids
ftw02024  Quorum sensing
Module
ftw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTW_2025 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    FTW_2025 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FTW_2025 (trpE)
Enzymes [BR:ftw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     FTW_2025 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ABO47649
LinkDB All DBs
Position
complement(1894230..1895774)
Genome map
AA seq 514 aa AA seqDB search
MSVKEPEKFLASHIYNIDYQEDLNKCFANLCTNKKNTILLESAEIDTKDKLKSILVLNSA
LRIACIENKVFIKSLSENGKYALKAIQENIKKDVDYKYDNNQLVLTFEFIKDYQLSESQK
LKKPSVFDALRIIKDSFEIYNEFSIFLAGLFAYDVVASFENIGKIKRKNKCPDYVFYLAD
TILVSDHQEQKTFIQVNSFGHQTITDLEDSVAAIKQNINNDIELKVEKFKNIEPKESIND
RDFCIVVDKLKSHIIDGDIFQVVPSRSFFLPCQNSLEVYKELKRTNPSPYMFYMQDEDFI
LFGTSPESALKYQKSTNQVEIYPIAGTRRRAKNSDGSINADLDSRIELELRLDAKENAEH
MMLVDLARNDVARISKTGTRYVADLLKVDRYSHVMHLVSRVVGQLADDLDALHAYQASMN
MGTLTGAPKIKAMQLISEVEKQTRGVYGGAIGYFNGYGDLDSCIVIRSAYVENGVAEIQA
GAGVVLDSIPIAEADETRTKAQAVISAIKNVHGV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaagaaccagaaaaatttttagcatcacatatttataatatagattatcaa
gaagatttaaataaatgctttgctaatttatgtacaaataaaaaaaatactattttatta
gaatcagcagaaatagatacaaaagataaactcaaaagtatcttagtgcttaatagtgct
ttaagaatagcttgtattgaaaataaagtctttataaaatcattatctgaaaatggtaaa
tatgctctaaaggctatacaggaaaatataaaaaaagatgttgattataaatatgataat
aaccaattagttttaacatttgagttcatcaaagattatcaacttagtgaatctcaaaaa
ttaaaaaaaccatctgtatttgatgctttgagaattataaaagatagttttgaaatatat
aatgaatttagtattttcttagcaggattatttgcttatgatgttgttgctagctttgaa
aatataggcaaaattaagcgtaaaaataaatgtccagattatgtattttaccttgctgat
acaatacttgtaagtgatcatcaagagcagaaaacgtttattcaagttaatagttttggt
catcaaacaataacagatttagaggatagtgttgctgcaattaagcaaaatataaataat
gatatagagttaaaagttgaaaagtttaaaaatatagaacctaaagaatcaataaatgat
agagatttttgtattgttgtagataaacttaaatcacatattatagatggtgatatattt
caagtagtgccttcaagaagtttctttttgccatgtcaaaattctttagaagtatataaa
gaacttaaacgtactaatcctagtccttatatgttttatatgcaagatgaggattttatt
ctttttggaacatcaccagagagtgcattaaaatatcaaaagtcaaccaatcaagtagaa
atatatcctatagctggcacacgtagaagagctaaaaattctgatggaagtatcaacgca
gatttagatagtagaattgaactagagcttagattagatgctaaagaaaatgcggaacac
atgatgctagtagatttggcacgtaatgatgttgcaagaatatcaaaaacaggtacacgc
tatgtagcagatcttctaaaggttgatagatatagccatgtgatgcatttagtatctaga
gttgtgggtcaacttgctgatgatttggatgctttgcatgcttatcaagcttctatgaat
atgggcacactaacaggggctccaaaaataaaagcgatgcaactaatatctgaagttgaa
aagcaaacaagaggtgtttatggcggagctataggttatttcaatggttatggtgatttg
gatagttgtatagttattcgttctgcttatgttgaaaatggtgttgctgaaattcaagct
ggcgcaggcgtggttttagattctataccaatagcagaagctgatgagactaggacaaaa
gcacaagctgtaatatcagctattaaaaacgtacatggagtgtaa

DBGET integrated database retrieval system