KEGG   Francisella tularensis subsp. novicida U112: AW25_1111Help
Entry
AW25_1111         CDS       T03874                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ftx  Francisella tularensis subsp. novicida U112
Pathway
ftx00550  Peptidoglycan biosynthesis
ftx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AW25_1111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ftx01002]
    AW25_1111
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ftx01011]
    AW25_1111
Enzymes [BR:ftx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AW25_1111
Peptidases and inhibitors [BR:ftx01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AW25_1111
Peptidoglycan biosynthesis and degradation proteins [BR:ftx01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AW25_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 PBP5_C Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJI61737
UniProt: A0Q6D0
LinkDB All DBs
Structure
PDB: 

Position
complement(1165906..1167240)
Genome map
AA seq 444 aa AA seqDB search
MKLTKIALLTASITAGVAFAAPNISAGSDPYFNGANGLAQKDIIIRPANIELDAPAWVAM
DYRTGDIVSEKNMDVRRAPASLTKIMTSYIVASEIKAGNLSWDTMVPISENAASTGGSKM
YVKAGAKVSVRNLVTGMDVVSGNDATIALAEYIGGTTQAFTDLMNQTAKAIGMNNTHFAN
PDGLPGGEQYTTAHDMALLARSYIYNFPEAYKVYDDKGLVWNATKQDSVSIADRKQCLPK
FDRATGNVIESYTVKGLDDQAKDKCNKLFPKGDNFVLQNNRNRLLFTFDGADGMKTGHTD
AAGYCLVSSAKQDSERFISVVLGTTSSAKRDSESAKLLRYALSKYENVLLYKANSPVTIS
ADNIPNAKAGQKLTVASNQNIYKTVPKTYVPYLKQGIEFNPNLNAPIKTGQTVGNLVITL
GDTKEEIASIPVVAMNNVSQKGWW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacaaaaatagctttattaacagctagtataacagcgggggtagcttttgct
gcgcctaatatatctgccggctctgatccttatttcaatggagctaatggactcgcgcag
aaagatattattataagacctgcaaacattgagctagatgctccagcttgggtagcgatg
gattatcgtactggagatattgttagtgaaaaaaatatggatgtgagaagagcccctgca
agcttaactaaaatcatgacttcctatatagttgctagtgaaataaaagctggtaatcta
agctgggatacaatggtcccaattagtgaaaatgctgcttctacaggtggttcaaagatg
tatgttaaagccggtgctaaggtctctgtaagaaatcttgtaactggtatggatgtagtg
tctggtaatgatgctactattgctcttgctgaatatatcggcggaactacacaagccttt
actgatttaatgaatcaaacagcaaaggctattggtatgaataatactcattttgctaat
ccagatggacttccaggtggtgagcaatatactactgctcatgatatggcgttgcttgca
agatcatacatatataatttcccagaagcatataaagtatacgatgataagggcttagtt
tggaatgccacaaaacaagactccgtaagtattgctgatcgtaaacagtgcttacctaag
tttgatcgcgctactggaaatgtcatagagagctatacagtcaaaggtcttgatgatcaa
gctaaagataaatgtaataagcttttccctaaaggtgataatttcgtattacaaaataat
agaaatagattactatttacatttgatggggctgatggtatgaagactggtcatactgat
gcagctggatactgtctagtttcatctgctaaacaagatagcgagagatttatttctgta
gttcttggcactactagttctgctaagagagattcggaatcagctaaattactaagatat
gctctgagtaagtatgaaaatgtacttttatacaaagcaaattctccagttacaattagt
gctgataatatccctaatgcaaaagctggacaaaagttaactgtagcttcaaatcaaaat
atttataaaacagtacctaaaacttatgtcccttatctaaagcaaggtatagagtttaat
ccaaatttgaacgctcctattaaaacaggtcaaactgtaggtaatttagtgattactcta
ggtgatactaaggaggaaattgctagtatacctgtagttgctatgaataatgtttcacaa
aaaggttggtggtaa

DBGET integrated database retrieval system