KEGG   Francisella tularensis subsp. novicida U112: AW25_287Help
Entry
AW25_287          CDS       T03874                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftx  Francisella tularensis subsp. novicida U112
Pathway
ftx00250  Alanine, aspartate and glutamate metabolism
ftx00410  beta-Alanine metabolism
ftx00430  Taurine and hypotaurine metabolism
ftx00650  Butanoate metabolism
ftx01100  Metabolic pathways
ftx01110  Biosynthesis of secondary metabolites
ftx01120  Microbial metabolism in diverse environments
ftx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AW25_287
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AW25_287
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AW25_287
   00430 Taurine and hypotaurine metabolism
    AW25_287
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AW25_287
Enzymes [BR:ftx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AW25_287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI60776
UniProt: A0Q8J3
LinkDB All DBs
Position
306718..308064
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPTNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVINSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagcgacgttttgccaaacggaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaaacccaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggtatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcgccacttggggttggttgggttatttgggct
gataaaaagtacttaccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcattgaatttctcgcgacctggtggtcagatagtagcccagtattataat
tttgttaggttaggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaccaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttagca
cagttgatgattagagatttagttgcggtgattaattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system