KEGG   Francisella tularensis subsp. novicida U112: AW25_861Help
Entry
AW25_861          CDS       T03874                                 

Definition
(GenBank) cys/Met metabolism PLP-dependent enzyme family protein
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
ftx  Francisella tularensis subsp. novicida U112
Pathway
ftx00220  Arginine biosynthesis
ftx00250  Alanine, aspartate and glutamate metabolism
ftx00270  Cysteine and methionine metabolism
ftx00330  Arginine and proline metabolism
ftx00350  Tyrosine metabolism
ftx00360  Phenylalanine metabolism
ftx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftx00401  Novobiocin biosynthesis
ftx01100  Metabolic pathways
ftx01110  Biosynthesis of secondary metabolites
ftx01130  Biosynthesis of antibiotics
ftx01210  2-Oxocarboxylic acid metabolism
ftx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AW25_861
   00270 Cysteine and methionine metabolism
    AW25_861
   00220 Arginine biosynthesis
    AW25_861
   00330 Arginine and proline metabolism
    AW25_861
   00350 Tyrosine metabolism
    AW25_861
   00360 Phenylalanine metabolism
    AW25_861
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AW25_861
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    AW25_861
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftx01007]
    AW25_861
Enzymes [BR:ftx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     AW25_861
Amino acid related enzymes [BR:ftx01007]
 Aminotransferase (transaminase)
  Class I
   AW25_861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJI60244
UniProt: A0Q717
LinkDB All DBs
Position
917418..918611
Genome map
AA seq 397 aa AA seqDB search
MASLNKKIQNVSTSPTNAMAALAKQIKDQGNDVISLAIGEPGFSTPDIIKAAGIEAINKD
ITKYTNVDGLKELREAIVARYKREYGIEFAADQVCVTSGAKHSLHNIFNCILEAGDEAIF
FAPYWVSYPDMIALTGAKPVVVETKFENNFEIDVTDLEKHITAKTKAVIINSPNNPTGLI
YSKKCIKDLANLLRKYPNIWIIGDDIYDQLYFKDRVTLITEVAPDLADRYVIASGVSKNF
AMTGWRVGFTIAPKLLNDALKKFQSQSATCACSISQYAAITAMNMPAQDLQYFVESYKQK
AQFVTKCLEAMPYIDVKSAEGTFYLFPDLRKLLEHTNFSTDVELCNALLREEYVAMMPGV
AFGLSGFARISCANEMPELEEAMTRVARFIDRHVSTK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgcttaacaaaaagattcaaaatgtttcgacttcaccaactaatgctatggcg
gcattagcaaagcaaatcaaagatcaaggaaatgatgtaatctctcttgctatcggagaa
cctggatttagtaccccagatattatcaaagctgctggtatcgaagcaataaataaagat
attactaaatatacaaatgtcgatggtcttaaagaactgcgtgaggctatagtagctcgt
tacaagcgtgaatatggtattgagtttgctgcagatcaagtctgtgttacctccggggct
aagcatagtttgcataatatttttaactgtattttagaagcaggtgatgaggcgattttc
tttgcaccgtattgggtatcatatccagatatgatagcacttacaggagcaaaaccagta
gttgtcgaaactaagtttgagaataactttgagatagatgttacagacttagaaaaacat
attacagcaaaaactaaagctgtgattatcaactcacctaataatcctactggtttgatc
tactctaaaaaatgtatcaaagatttagcaaatttacttagaaagtatccaaatatttgg
attattggtgatgatatttatgaccaactttactttaaggatagagttacattgataact
gaagtagcacctgatttggctgatagatatgtgatcgctagtggtgtgtcaaaaaacttt
gcgatgactggttggcgtgtgggttttacaatagcgccaaagcttttaaatgatgcactg
aaaaaattccagtcacaatctgctacttgtgcttgctcgatatcacaatatgctgcaatt
actgctatgaatatgccagcacaagatttacagtattttgttgaatcttacaagcaaaaa
gcacaattcgttactaagtgtctagaagctatgccatatattgatgtaaagagtgctgaa
ggtactttttatctttttccagatcttagaaaattacttgagcatactaattttagtact
gatgtcgagctatgtaacgcactacttagagaagagtatgtagcgatgatgcctggtgtg
gcatttggtttatcaggttttgctaggataagttgtgctaatgaaatgccagagcttgaa
gaggctatgactagagtagccagatttattgataggcatgtttcaacaaagtaa

DBGET integrated database retrieval system