KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_205Help
Entry
CH70_205          CDS       T03875                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty00250  Alanine, aspartate and glutamate metabolism
fty00410  beta-Alanine metabolism
fty00430  Taurine and hypotaurine metabolism
fty00650  Butanoate metabolism
fty01100  Metabolic pathways
fty01110  Biosynthesis of secondary metabolites
fty01120  Microbial metabolism in diverse environments
fty02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CH70_205
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH70_205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH70_205
   00430 Taurine and hypotaurine metabolism
    CH70_205
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH70_205
Enzymes [BR:fty01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH70_205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJJ46763
UniProt: A0A0B6KN21
LinkDB All DBs
Position
207434..208780
Genome map
AA seq 448 aa AA seqDB search
MALHGKKDTINNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLATFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGIDIPVHVDAASGGFL
APFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWADKKYLPDDLIFNVNYLGGNM
PTFALNFSRPGGQIVAQYYNFVRLGFEGYKKVHQLCYDVAEYIAKELRKMEIFEIIHAGE
GGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPTNREDLVVMRVLVRRGFSYDLA
QLMIRDLVAVINSLEGKLKILKRSSFAH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattaataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttggcgacgttttgccaaactgaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatcctggcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggcatggcaatgaagtggcgttggcgagataaaatgaaagctcaaggtaaa
gattatacaaaacctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcaaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttggg
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcatagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaagagttaagtcaatt
aactcatcaggacataagtttggcttatcaccacttggggttggttgggttatttgggct
gataaaaagtacttgccagatgatttgatttttaatgttaattacctaggtggtaatatg
ccaacatttgcactgaatttctcgcgacctggtggtcagatagtagcccagtattataat
tttgttaggttaggttttgaaggctataagaaagttcatcagctttgctatgatgttgca
gaatatattgctaaagagcttagaaaaatggaaatttttgaaattattcatgctggagag
ggtggtattcctgcggttagctggtcacttaaagcaactaaagagtatagtttgtttgat
atatctgagaaagttcgcgctaaaggttggcaaatagcagcttacacaatgccaaccaat
cgtgaagatttagtggttatgcgtgtattagttagaagaggctttagttatgacttggca
cagttgatgattagagatttagttgcggtgattaattcattagagggaaagttaaaaata
ttaaaaaggagtagttttgcgcattag

DBGET integrated database retrieval system