KEGG   Francisella tularensis subsp. novicida DPG 3A-IS: CH70_702Help
Entry
CH70_702          CDS       T03875                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fty  Francisella tularensis subsp. novicida DPG 3A-IS
Pathway
fty00061  Fatty acid biosynthesis
fty00780  Biotin metabolism
fty01100  Metabolic pathways
fty01130  Biosynthesis of antibiotics
fty01212  Fatty acid metabolism
Module
fty_M00083  Fatty acid biosynthesis, elongation
fty_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:fty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH70_702 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH70_702 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CH70_702 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fty01004]
    CH70_702 (fabI)
Enzymes [BR:fty01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CH70_702 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CH70_702 (fabI)
Lipid biosynthesis proteins [BR:fty01004]
 Fatty acid synthase
  Component type
   CH70_702 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AJJ48019
UniProt: A0A1J0KYQ6
LinkDB All DBs
Structure
PDB: 

Position
724349..725131
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVL
PCDVTSDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISA
YSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGIAKASLEATVRYTALALGED
GIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGI
TGEVVHVDAGYHCVSMGNVL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctagcaggaaaaaaaatattaatcactggacttttaagtaataagtcaatt
gcatatggtattgctaaagctatgcatagagagggagctgagcttgcttttacttatgtt
ggacagttcaaagatagagtggaaaaattatgtgcagaatttaatccggctgcagttttg
ccttgcgatgtgacttctgatcaagagattaaggatttatttgtagaactaggtaaagtt
tgggatggtctagatgccatagttcattctatagcttttgcaccgcgtgatcagttagaa
ggtaactttattgactgtgtaactcgcgaaggttttagtatcgctcatgatattagtgcc
tattcttttgcagcattagctaaagaaggtcgtagtatgatgaaaaatcgtaatgcttct
atggtagcacttacttatattggagcagaaaaagctatgccaagttacaatactatgggt
attgctaaagcatctttagaagctacagttagatatacagcattagctttaggtgaggat
ggtatcaaggtaaatgctgtatcagctggtcctatcaaaactctggcagcttctggtata
tcaaacttcaagaagatgcttgattataatgctatggtttctccacttaagaaaaatgtt
gatattatggaagttggtaatactgtagcatttttatgttcagatatggcaactggtatc
actggagaagttgtccatgttgatgctggatatcattgtgtgtctatgggtaatgttctt
taa

DBGET integrated database retrieval system