KEGG   Francisella tularensis subsp. holarctica 425: CH68_2018Help
Entry
CH68_2018         CDS       T03715                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ftz  Francisella tularensis subsp. holarctica 425
Pathway
ftz00250  Alanine, aspartate and glutamate metabolism
ftz00410  beta-Alanine metabolism
ftz00430  Taurine and hypotaurine metabolism
ftz00650  Butanoate metabolism
ftz01100  Metabolic pathways
ftz01110  Biosynthesis of secondary metabolites
ftz01120  Microbial metabolism in diverse environments
ftz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CH68_2018
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH68_2018
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH68_2018
   00430 Taurine and hypotaurine metabolism
    CH68_2018
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH68_2018
Enzymes [BR:ftz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH68_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI67361
UniProt: A0A0B6E484
LinkDB All DBs
Position
complement(1781319..1782440)
Genome map
AA seq 373 aa AA seqDB search
MALHGKKDTIDNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELMLDGNSKQNLETFCQTE
VDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAA
MLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMT
PEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFERQTGVDIPVHVDAASGGFL
APFVEPELKWDFRLPISPLGVGWVIWADKKYLPDDLIFNVNYLGGNMPTFALNFSRPGGQ
IVAQYYNFVRLGFEGYKKVHQLCYDIAEYIAKELRKMEIFEIIHAGEGGIPAVSWSLKAT
KEYSLFDISESSR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcattacatggtaaaaaagatacaattgataaccttgatttttttgaacaatcttta
ccaaagtttaaacttccactaaattcacaagatcctttagaagtgtatcaagaaatcaaa
gatgagttaatgctagatggtaattcgaagcaaaatttagagacgttttgccaaacggaa
gttgatgatttcattcacaagcttatggatgattgcattgataaaaatatgattgacaaa
gatgaatatccgcagactgcggaaatagagtctcgctgtgtaaatatccttgcaaaccta
tggaactcttcagcagaaaatgcaattggctgctcaacgactggctcatcagaggctgct
atgcttggcggtatggcaatgaagtggcgttggcgagataaaatgaaagcgcaaggtaaa
gattatacaaaacctaatcttgttacaggacctgtgcaagtgtgctggcataaatttgct
agatattgggatattgagcttagagaaattccaatgtcgaatgaaagtttaataatgact
ccagaggctgtgcttgaaagatgtgatgaaaatacaatcggtgtggtgccaactcttgga
gtgacttttacagggcagtatgagccagtagaacaggtatgtaaagctcttgatgatttt
gaacgacaaacaggcgtagatattccagttcatgttgatgcagcatctggaggttttttg
gcaccatttgtagagcctgaacttaagtgggactttagattaccaatatcgccacttggg
gttggttgggttatttgggctgataaaaagtacttaccagatgatttgatttttaatgtt
aattacctaggtggtaatatgccaacatttgcactgaatttctcgcgacctggtggtcag
atagtagcccagtattataattttgttaggttgggttttgaaggctataagaaagttcat
cagctttgctatgatattgcagaatatattgctaaagagcttagaaaaatggaaattttt
gaaattattcatgctggagagggtggtattcctgcggttagctggtcacttaaagcaact
aaagagtatagtttgtttgatatatctgagagttcgcgctaa

DBGET integrated database retrieval system