KEGG   Francisella tularensis subsp. holarctica 425: CH68_499Help
Entry
CH68_499          CDS       T03715                                 

Gene name
mtnN
Definition
(GenBank) MTA/SAH nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
ftz  Francisella tularensis subsp. holarctica 425
Pathway
ftz00130  Ubiquinone and other terpenoid-quinone biosynthesis
ftz00270  Cysteine and methionine metabolism
ftz01100  Metabolic pathways
ftz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ftz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CH68_499 (mtnN)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CH68_499 (mtnN)
Enzymes [BR:ftz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     CH68_499 (mtnN)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     CH68_499 (mtnN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AJI66949
UniProt: A0A0B3VRG6
LinkDB All DBs
Position
429316..430002
Genome map
AA seq 228 aa AA seqDB search
MRKIAILGAMEIEILPILAKLDNYETIEYANNKYYLANYQDKELVIAYSKIGKVFSSLTA
TIMIERFGVEALLFSGVAGGLQDLKVGDMIAATATVQHDVDITAFGYPYGKIPISEVEIK
TSAKLLKQAQNVANELGLNLHTGVIATGDQFVHCAERKDFVIKEFDAKAIEMEGASVNLI
CNEMGVPSLILRSISDTADGDAPENFDEFAKIAAKRSANFIMQILSNI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgcaatattaggagcaatggagatagaaattttaccaattctagctaag
ttagataactatgaaactatagaatatgcaaataacaaatattatctagcaaattatcag
gataaagagcttgtaatagcttatagtaaaattggtaaagtattctcaagcttaacagca
acgataatgattgagcgctttggtgttgaggcattattgtttagcggtgttgctgggggg
ctacaagatttgaaagtaggtgatatgattgctgcaactgctacagtacaacacgatgtt
gatatcaccgcatttggctatccatatggtaagattcctatatcggaagttgaaattaaa
acatcggctaaacttttaaaacaagcacaaaatgttgctaatgaacttggtcttaatcta
catactggtgttatagctacaggagatcaatttgttcattgtgcagagagaaaagatttt
gtaatcaaagagtttgatgcaaaggctatagaaatggaaggagcaagtgttaatcttatc
tgtaatgaaatgggtgtgccaagtttaattctaagaagtatttctgacactgctgatggc
gatgcacctgaaaattttgatgagtttgctaagatagctgctaaaagatccgcaaacttt
ataatgcaaatacttagtaatatataa

DBGET integrated database retrieval system