KEGG   Fusobacterium ulcerans: C4N20_03410
Entry
C4N20_03410       CDS       T05433                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ful  Fusobacterium ulcerans
Pathway
ful00052  Galactose metabolism
ful01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ful00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C4N20_03410
Enzymes [BR:ful01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     C4N20_03410
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Gp_dh_N Spermine_synth 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N Sacchrp_dh_NADP ADH_N_2 Copper-fist 3HCDH_N
Other DBs
NCBI-ProteinID: AVQ27177
UniProt: A0A2P1S1R5
LinkDB
Position
complement(756444..757541)
AA seq 365 aa
MKKIELFYFFYFDYNQIKKIKIKKGGLKLRAAILEENNVVKIQEIEMPEIKDEDVLVQVK
YSGVCGSDIPRLFNNGARFYPIILGHEFSGIVTKVGSKVENIVVGDKVAVAPLEPCMKCS
DCIKGHFSQCKHYSFIGSRKQGAWAEYVTVPAKNAVKLPEGVSLKEGAFFEPLTVALHGL
SLLDYPVNKKIAILGMGTIGQLVLQCVKSSIQKEITAVDINDEKLEFSIELGADNTYNPL
KATGKLNDYDLVIETSGVPENFKKALEIAGNKGNVLFIGTPHGNVEYTPVEFENINRKEL
TLTGSWMNYSNIFPGEEWEMANSLFKENKVKIDKLIAKLCTLDEFPEVVNKLENKEIQGK
VVIEF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaaaagatagaacttttttattttttttattttgattataatcagattaagaaaatt
aaaataaaaaaaggagggttaaaattgagagcagcaattttggaagaaaataatgttgta
aagattcaagaaattgaaatgccagaaataaaagatgaagatgttttagtacaggtaaaa
tattctggagtatgtggttcagacataccaagactatttaataatggtgctagattttat
ccaataatacttggacatgaattttcaggaattgttacaaaggtaggaagtaaagttgaa
aatattgtagtaggagataaagtagcagtggctcctttagaaccatgtatgaaatgcagc
gattgtataaaagggcatttttctcaatgtaagcattactcatttatagggtcgagaaaa
cagggagcatgggctgaatatgttacagttccagctaaaaatgcagtaaaacttccagag
ggagtaagcttaaaggaaggagccttctttgaaccattgacagtagcacttcatggattg
agtcttttagattatccagttaataagaaaatagctattttaggaatgggaacaatagga
cagcttgtacttcaatgtgtgaaatcttctattcaaaaagaaattacagcagtggacata
aatgatgagaagttagagttttctatagaactaggagctgataacacatacaacccgctt
aaagctacaggaaaattaaatgactatgacttggttattgaaacttcaggagtgccagaa
aattttaaaaaggcattggaaatagcaggaaataagggaaatgtattgtttataggaaca
cctcatggaaatgttgaatatactccagtagaatttgaaaatataaatagaaaagaattg
acattaactggttcatggatgaattattctaatatttttccaggggaagaatgggaaatg
gcaaattcattgtttaaagaaaataaagtaaaaatagataaattaattgcgaaattatgt
acattggatgaatttccagaagtagtaaataaacttgaaaataaagaaattcaaggaaaa
gtagttatagagttttaa

DBGET integrated database retrieval system