KEGG   Fusobacterium nucleatum subsp. animalis 4_8: HMPREF0409_00729Help
Entry
HMPREF0409_00729  CDS       T02680                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fus  Fusobacterium nucleatum subsp. animalis 4_8
Pathway
fus00250  Alanine, aspartate and glutamate metabolism
fus00430  Taurine and hypotaurine metabolism
fus00650  Butanoate metabolism
fus01100  Metabolic pathways
fus01110  Biosynthesis of secondary metabolites
fus01120  Microbial metabolism in diverse environments
fus02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0409_00729
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0409_00729
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF0409_00729
   00430 Taurine and hypotaurine metabolism
    HMPREF0409_00729
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0409_00729
Enzymes [BR:fus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HMPREF0409_00729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGM23454
UniProt: R9RBA6
LinkDB All DBs
Position
complement(1022543..1023922)
Genome map
AA seq 459 aa AA seqDB search
MAKKSLRKNIEINPIFARPGEVTSAPADRFPTDSMLPETAYQIVHDESMLDGNARLNLAT
FVSTWMDESANKLYSEAFDKNAIDKDEYPATARVETNCWHMLADLWHAPDPDNAIGCSTT
GSSEACMLGALALKRRWQEKMKKLGKSTAHPNLIMSSAVQVCWEKFCNYFDVEPRYVPIS
LEHKVLDGYDLEKYVDENTIGVIAIMGVTYTGMYEPVKDIAKALDKIEKDTGLDIPIHVD
AASGGMIAPFIQPELEWDFRIPRVYSINTSGHKYGLVYPGLGWVVWRSTAHLPESLIFKV
SYLGGEMPTFALNFSRPGAQILLQYWAFLRYGFNGYKTVQQSTMDVANHLADEINKMDMF
TLWNHPTDIPVFAWMLKESPNRKWTLYDLSDRLRMKGWQVPAYPMPINLTDITVQRIVVR
NGLSMDLADRFLDDIKSQVKYLESLEYKMPKNNTRSFRH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaagtttaagaaagaatattgaaattaatccaatttttgcacgtccaggt
gaagttacatctgctcctgccgatcgttttccaacagactctatgttaccagaaacagct
taccaaattgtacatgatgagtctatgttagatggaaatgctcgtttaaatttagcaact
tttgtttcaacatggatggatgaaagtgctaacaaattatactctgaagcatttgataaa
aatgcaatagataaagatgaatatcctgctactgcaagagttgaaacaaattgttggcat
atgcttgctgatctttggcatgcaccagatcctgacaatgctattggttgttctacaact
ggttcatctgaagcatgtatgcttggagctttagcacttaaacgtagatggcaagaaaaa
atgaaaaaacttggaaaatctactgctcatcctaatcttataatgagctctgctgtacaa
gtttgctgggaaaagttttgtaattattttgatgttgagccaagatatgttccaataagt
ttagaacataaagttttagatggctatgacttagaaaaatatgtagacgaaaatacaata
ggtgttatagcaataatgggagtaacttatacaggaatgtatgaaccagtaaaagatatt
gctaaggctttagataaaattgaaaaagatactggattggatatacctatacatgttgat
gcagcttctggaggaatgatagctccatttattcaaccagaattagaatgggattttcgt
ataccaagagtatattctattaacacatcaggacataaatatggtttagtttatcctgga
cttggttgggtagtttggcgtagtacagcacatcttcctgaaagtcttatatttaaagta
agttatcttggaggagaaatgccaacatttgcattgaatttctctcgtcctggtgcacaa
atattattacaatattgggcatttttaagatatggctttaatggatacaaaacagtacaa
caatctacaatggatgtagcaaatcatcttgctgatgaaattaataaaatggatatgttt
acactttggaatcatccaacagatattcctgtatttgcttggatgcttaaagaatctcct
aatcgtaaatggactttatatgatttatcagatagattacgtatgaaaggttggcaagtt
ccagcttatccaatgccaataaatcttacagatataactgttcaaagaatagttgtaaga
aatggacttagtatggatcttgctgatagatttttagatgatataaaatctcaagtaaaa
tatcttgaaagtcttgaatataaaatgcctaagaataatactagaagtttccgccactga

DBGET integrated database retrieval system