KEGG   Fragaria vesca (woodland strawberry): 101292103Help
Entry
101292103         CDS       T02666                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00052  Galactose metabolism
fve00500  Starch and sucrose metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101292103
   00500 Starch and sucrose metabolism
    101292103
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101292103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101292103
NCBI-ProteinID: XP_004295461
LinkDB All DBs
Position
LG3
AA seq 916 aa AA seqDB search
MLITFMRGTTYVCLELYIIPFLSHHPSNSSQSKTHFQQDQMERNRSKHTAKATFHHLLPV
FFFYVFFSLDCLFAQELVGYGYKVQSVNSSDSSGKTLTVNLGLINSSSVYGPDISNLTLY
VSYETKDRLRVRITDSTQQRWEIPQEIIPRQNQTSQNFSVTDNDLVFTLRNTTPFGFTIT
RRSTNDTVFDTTPNPSDPNTTFIFKDQYIQLSSSLPNNRSSLYGLGEHTKSTFKILANQM
LTLWAADIASVNPDLNLYGSHPFYMDVRSPSGDGRVKAGTTHGVLLLNSNGMDVNYTGDR
VTYNVIGGVVDLYFFAGPTPESVMDQYTELIGRPAPMPYWSFGFHQCKYGYKNVSDLEGV
VAGYANASIPLDVMWTDIDYMDAYKDFTLDPVNFPLDKMQNFTNTLHQNGQKYVVILDPG
ISINDSYGSYTRGKEADIYIKRDGIPYQGNVWPGDVYFPDFVHPQSEPYWENEIKLFIDQ
LPVDGLWIDMNEVSNFQTSAPTPNSTLDDPPYKINDSGGHRPILSKTIPGSALHYGNVTE
YNVHNLYGMLQAKATNKALTNVTGKRPFVLSRSTFVSSGKYAAHWTGDNGARWNDLAYSI
PGILNFGLFGVPMVGADICGFIGDTNEELCRRWIQVGAFYPFSRDHSDKNSIRQELYVWE
SVAASAKKVLGLRYRLLPLYYTSMYQAHKNGTPIARPLFFSFPEDTNTYDISSQFLIGKG
VMVSPVLQQGATSVEAYFPAGNWYDLFNYTSLSVDTGKNVTLDAPPDHINVHVHEGNILA
LQGEALTTQAARNTSFELLVVIGSSNESAGEVFLDDGEELEMGGEGGKWSFVRFHSARAQ
NGSLILSSNVENGDFALSQGWIIDKITVLGLDKDHAKVESSVSLPIGKEFELELKPNQTV
TKTLFSRDQLHTQLFN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcaccttcatgcgtggcaccacgtacgtctgcttagagctctatataatccca
tttctgtctcatcatccatcaaactcctcccaatccaaaacccatttccaacaggatcaa
atggaaagaaaccgatcaaaacacacagcaaaggccacattccatcatcttctaccagtc
ttcttcttctatgttttcttctctcttgattgcttatttgcacaagagttagttggctat
ggatataaagtccagtctgtaaatagttctgattcctccggaaagacattgacggttaac
cttggcctcatcaacagctcctcagtttatggacctgacatctcaaatctcaccctctat
gtcagctatgagacaaaagaccgcttgagagttcgaataacagactcaacccaacaaaga
tgggagatcccacaagaaatcatcccccgccaaaaccaaacttcacaaaacttttccgtc
accgacaacgacctcgtttttaccctccgcaataccaccccattcggattcaccatcacc
cgccgctccaccaacgacaccgttttcgacaccaccccgaacccctccgaccccaacacc
accttcatcttcaaagaccaatacatccagctctcttcctccctccccaacaacaggtca
tccctgtacggcctaggagaacacaccaagagcaccttcaagatcctagccaatcagatg
ctaacactctgggccgccgacatcgccagcgtcaatcccgacctcaatctgtatggctcc
caccccttctacatggacgtcaggtcgccgtccggtgatggcagggtcaaggcgggaacc
actcacggcgtgctgcttctgaatagcaatggcatggatgtaaattacaccggggacagg
gtcacttataatgtgattggcggagttgtggacttgtatttctttgcgggtccgacaccc
gaatcggtgatggaccagtatacggagctcattggtcgacccgccccgatgccatattgg
tctttcggattccaccagtgtaaatatggttacaagaatgtttctgaccttgagggggtg
gttgctggttatgcaaacgctagtatccctcttgatgttatgtggacagacatcgactac
atggatgcctacaaagatttcactcttgatcccgtcaactttccactagacaagatgcag
aactttaccaacacccttcaccaaaatggtcagaaatacgtggtcattttggatcccggt
attagtattaatgacagctatggatcctacaccagagggaaggaagcagatatatacata
aaacgtgatggcattccttaccagggaaatgtatggcctggtgatgtttactttcctgat
tttgttcatccacaaagtgaaccgtattgggagaatgagatcaaactatttatagaccag
ctacctgttgatggcctttggattgatatgaatgaagtctcaaatttccaaacttctgct
ccgactcctaattctacacttgatgacccaccgtacaagatcaacgattctggcggccac
cgtccgatcctcagtaagactattccaggatcagctcttcactatggtaatgttacagag
tacaatgttcataacctatatgggatgttacaagccaaagcaacaaacaaggccttgacc
aatgtcactggtaagagaccgtttgttctctcgagatcaacttttgtaagctctggtaag
tacgcagcacattggactggagacaatggtgcaagatggaatgacttggcatactcaatt
ccggggattttgaattttggcctctttggagttccaatggttggagctgatatatgtggt
tttattggagatactaatgaagaactctgccggcgttggattcaggtaggggccttttac
cccttttcaagagatcactcggacaagaattcaatccggcaagagctctatgtttgggaa
tcggtggctgcatcagcaaagaaggtgctggggctgcgttaccggctgctccccttgtac
tacacatcgatgtatcaagcacacaagaacgggaccccaattgcaaggcccctattcttc
tcatttccagaagacaccaatacatacgacatcagttcgcagtttctgattggtaaaggc
gtaatggtgtcacctgtgttacagcaaggagcaacttcagttgaggcatattttcctgca
ggaaattggtatgatcttttcaactacacatcattaagtgtagacactggaaagaatgtt
acgttggatgcacctcctgatcatatcaacgttcatgtccacgaaggtaacattctggcc
ttgcaaggagaggccttgacaacacaagcagcccgaaacacttcattcgaacttttggtg
gtcattggtagtagcaatgagagtgctggagaagtgttcttggacgatggagaggagctt
gaaatgggaggagagggagggaagtggagcttcgtgaggtttcattctgctcgagcacaa
aatggaagtctaattttgagctcaaatgtcgaaaatggagattttgcactaagccaaggc
tggatcattgataaaattaccgtcctcgggttggacaaagatcatgccaaggtagagtct
agtgtatcccttcctataggaaaggagtttgagttggagctgaagccgaatcagacagtg
acgaaaacactctttagtagagatcagttgcatacacaactgtttaattaa

DBGET integrated database retrieval system