KEGG   Fragaria vesca (woodland strawberry): 101294194Help
Entry
101294194         CDS       T02666                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00220  Arginine biosynthesis
fve00250  Alanine, aspartate and glutamate metabolism
fve00710  Carbon fixation in photosynthetic organisms
fve01100  Metabolic pathways
fve01200  Carbon metabolism
fve01210  2-Oxocarboxylic acid metabolism
fve01230  Biosynthesis of amino acids
Module
fve_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101294194
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101294194
   00220 Arginine biosynthesis
    101294194
Enzymes [BR:fve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101294194
Amino acid related enzymes [BR:fve01007]
 Aminotransferase (transaminase)
  Class I
   101294194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Pox_A_type_inc
Motif
Other DBs
NCBI-GeneID: 101294194
NCBI-ProteinID: XP_004303756
LinkDB All DBs
Position
LG6
AA seq 541 aa AA seqDB search
MRRFVNGRLRSLIVHSLQQTKQHPIRPHQHQTPPLLLSRFLSSSTSVVDVPNSMADKSPH
PATVTVDNINPKVVKCEYAVRGEIVILAGKLQEQLKANPGSLPFDEILYCNIGNPQSLGQ
QPITYFREVLALCDHPAILDKSETQGLFSADSIERAWEILDQIPGRATGAYSHSQGIKGL
RDSIAAGIEARDGYPSDPNDLFLTDGASPAVHTMMTLLIRSEKDGILCPIPQYPLYSASI
ALHGGTLVPYYLDEASGWGLEISDLKKQLEDARSKGVSVRALVVINPGNPTGQVLAEDNQ
RQIVEFCKQEGLVLLADEVYQENVYVPDKEFHSFKKVTRSMGYGENDIALVSFQSVSKGY
YGECGKRGGYMEVTGFSPEVREQIYKMASVNLCSNISGQILSSLVMSPPKVGDESYELYL
SEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHAAEAAKTAPD
AFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEFHKKFMDEFR
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgaacggcagactgagaagcctcatcgtccattctttacaacagacc
aaacagcacccgattcgtcctcaccagcaccaaacacctcctctacttctaagtcgtttc
ttgtcctcctccacttcagttgtcgacgtcccgaattccatggctgacaaatctcctcat
ccggctactgttactgttgacaatatcaatcccaaggttgtgaagtgtgaatatgctgtc
cgaggtgaaattgtcattcttgccgggaaacttcaagaacagttgaaggctaatccaggc
tctcttccttttgatgagatactttactgcaatattggaaatcctcagtctcttggtcag
caaccaatcacttatttccgagaggttcttgcattgtgtgaccatccagccatcttggac
aagagtgaaacacaaggcttgttcagtgctgattcaattgaacgggcatgggagattcta
gaccagattcctggaagagcaaccggtgcttacagtcacagtcagggtatcaaggggtta
cgtgactcaattgctgctggaattgaagctcgtgatggctatccttctgatccaaatgat
cttttcttaacagatggtgcaagccctgcggtccatacgatgatgacgttgctgataaga
tcagaaaaggatgggattctttgtcccattcctcaataccctttgtactctgcttcaatt
gctctccatggtggcacactggttccttactatcttgatgaggcatcagggtggggattg
gaaatttctgatttaaagaagcaattagaggatgcaaggtcgaagggtgtcagtgtaagg
gccttggtcgttataaatccaggcaacccaactggtcaggttcttgccgaggacaaccag
cggcagattgtggaattctgtaagcaagaagggcttgttttactggcagacgaggtgtat
caagagaacgtatatgttcctgataaggagtttcattcattcaagaaggtaacccggtct
atgggttacggtgagaatgatattgcactcgtatctttccaatcagtctctaaagggtac
tatggggagtgtggaaaaagaggtggatacatggaggtcactggattcagtcctgaagtg
agggaacaaatatacaaaatggcatccgtcaatctttgttctaatatcagtggtcaaatt
ctttcaagccttgtgatgagtccaccaaaggttggagatgaatcctatgagttgtatctt
tcagagaaagatggaattctgtcatctcttaaaaggcgtgcaaagacgttagaggatgcg
ttgaatagcctggagggtgtgacatgcaacagagctgagggggcaatgtacctctttccc
cgcatagaactgcctcaaaaggcaatccatgcagcagaagctgcaaagacggctccagat
gcattctattgcaaacgcctactgaatgccactggaattgtagttgttcctggttctggt
ttcggacaggttcctggcacctggcatttcagatgcacaatcctgcctcaagaggataaa
attccagccgtcgtcgaccgtctaacagagttccacaaaaaattcatggacgagttccgt
gactag

DBGET integrated database retrieval system