KEGG   Fragaria vesca (woodland strawberry): 101294217Help
Entry
101294217         CDS       T02666                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03030  DNA replication
fve03410  Base excision repair
fve03420  Nucleotide excision repair
fve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101294217
   03410 Base excision repair
    101294217
   03420 Nucleotide excision repair
    101294217
   03430 Mismatch repair
    101294217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fve03032]
    101294217
   03400 DNA repair and recombination proteins [BR:fve03400]
    101294217
Enzymes [BR:fve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101294217
    6.5.1.6  DNA ligase (ATP or NAD+)
     101294217
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101294217
DNA replication proteins [BR:fve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101294217
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101294217
DNA repair and recombination proteins [BR:fve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101294217
   NER (nucleotide excision repair)
    Other NER factors
     101294217
   MMR (mismatch excision repair)
    Other MMR factors
     101294217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 101294217
NCBI-ProteinID: XP_011459932
LinkDB All DBs
Position
LG1
AA seq 734 aa AA seqDB search
MSASRPPSAFDKLMSGARAAAAKKRKTPPAPIENPKSDEASATPIPAAESKPETVKEAQE
DAGKPAPAPRKPRAASVAEERTAQLTSRIELLKKKALEFDPSAVANWGKGDRVPFMFFAL
AFDLIDKESKRIVITDIVCNMLRTVIHTTPEDLLPAVYLSANKIAPAHEGLELGIGDASI
IKALAEACGKSEKDVKKRYDAEGDLGIVAQNSRSQQKMMWKPEPLTVTKVFNTFRVLAKE
SGKDSQEKKKNHMKALLVAAADCEPKYLIRLLQSKLRIGLAEQTLLAALGQAAVYSEEHS
TPPPEIQSPLEEAARIVKQVYSLLPVYDRIIPALLSGGVWNLSKTCSFTLGIPVGPMLAK
PSKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMEDGSVEIYSRNAERNTGKFPDVAVAVS
SCRLKKSSVKSFVLDCELVAYDRENNKILPFQVLSTRARKNVSISDIKIEVCIFAFDILF
HNGQPLTQEQLKVRREYLYDSFKEEAGVFQFATAITSKDIDEIQKFLDAAVNSSSEGLII
KTLNKDATYEPSKRSLNWLKLKKDYMDSFGDSLDLVPIAAFHGRGKRTGVYGAFLLACYD
SGNEEFQSICKIGTGFSEAVLEERSVGLREKVIPKSKTYYSYADTSNANTPDVWFEPSQV
WEVKAADLTISPVYRAAVGIVDANKGISLRFPRLVRVREDKKPEEASSSEQVAEMYTAQS
NKSSNHQDDKEDED
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctctcgcccaccctccgccttcgacaagctcatgtccggcgcacgcgccgcc
gccgccaagaaacgcaaaaccccaccggcccccatagaaaaccccaaatccgacgaggct
tccgctactccgatccccgccgcggaatccaaaccagaaacggtgaaagaagctcaagaa
gacgccggcaagccggcaccggcgccgaggaaaccgcgcgcggcgagcgtagcggaggag
cggacggctcaattgacgagtcggattgagctgctgaagaagaaggcgttggagtttgac
ccgagtgcagtggcgaattggggcaaaggcgatagggttccgtttatgttttttgctttg
gcttttgatttgattgacaaggagagtaagaggattgtgattacggatatagtgtgtaat
atgttgaggactgtaatccacaccacgccggaggatttgctcccggcggtttatctctcg
gctaataagattgctccggcgcatgaaggcttggagctcggcattggggacgcttcgatt
atcaaggcgcttgctgaggcttgtgggaagagtgagaaggatgttaagaagcgctatgat
gcagaaggagacttgggtattgttgcacagaatagccgttcacaacagaaaatgatgtgg
aagcctgaaccattgactgtcactaaggttttcaacacatttcgtgtccttgctaaggaa
tctgggaaggacagccaggaaaagaaaaagaaccatatgaaggcacttcttgttgctgcc
gctgactgcgaacctaagtatttgatccgtttgcttcagtcgaagttgcgaattggatta
gcagagcaaacccttttggccgcactgggacaagctgcagtctattctgaagaacattct
acaccacctcctgaaattcagtctcctttagaagaggctgcaaggattgttaaacaagtg
tactctctgcttcctgtctacgataggatcatccctgcccttctgagtggtggtgtttgg
aatctttcaaaaacatgtagttttactttgggtatcccagttggacctatgcttgcaaag
cccagtaaaggggtatctgagattgtacaaaagtttcaggatacagaatatacctgcgaa
tacaagtatgatggagaacgtgcgcagatacattacatggaggatggttctgttgagata
tacagtcgaaatgctgaacggaacactggaaagttccctgatgttgcggttgcagtgtca
agttgcaggttaaagaagtcgtctgtaaaatcatttgtcttagactgtgaattggttgcc
tatgaccgtgaaaataacaaaattctacccttccaggtacttagcactcgagcccgtaaa
aatgtgagcatcagcgatattaagattgaggtctgcatatttgcttttgatatattgttt
cacaatggtcaaccacttacacaagagcagctcaaagttcgtagagagtatctttatgac
tctttcaaggaagaagctggagtttttcagtttgccacagcaataacctcaaaggatatt
gatgaaatacagaagtttcttgatgctgccgttaattcaagttctgagggtttaataatc
aaaacattaaacaaagatgctacatatgagccttcaaagcggtcactgaactggctgaaa
ttgaagaaagattacatggatagttttggggactcactggacttggtacctattgctgct
ttccatggtcggggcaaacgtacaggtgtctatggcgcctttctccttgcttgctacgat
agcggtaatgaagaatttcaaagcatatgcaaaataggcactggattttctgaagctgtg
cttgaagaacgttctgtcggcctgcgtgaaaaagtgatacccaaatctaagacatactat
agctatgcagacacaagtaatgctaatactccagatgtatggtttgaacccagtcaggtt
tgggaggtgaaagccgctgacttgactattagtcctgtgtatcgtgctgcagtaggcata
gtggatgctaacaagggtatttctcttcgatttccacgccttgttcgtgttagggaagat
aaaaaaccggaggaagcttcatcatctgagcaggttgctgagatgtatactgctcaatct
aacaaaagttctaaccaccaagatgacaaggaagatgaagactag

DBGET integrated database retrieval system